Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3L8G7

Protein Details
Accession A0A5C3L8G7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
49-70NPHTTRQGRKHAKKELRRMGRGBasic
NLS Segment(s)
PositionSequence
38-38R
40-71AGGHKAALSNPHTTRQGRKHAKKELRRMGRGN
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MPFMTRRSRATTTHVPASLPSKGLGIFRQFKLRRNPNRVAGGHKAALSNPHTTRQGRKHAKKELRRMGRGNATHVPILTKIKRALGITSSRRRHTQRRTVIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.45
3 0.43
4 0.44
5 0.38
6 0.28
7 0.23
8 0.17
9 0.17
10 0.18
11 0.19
12 0.22
13 0.25
14 0.26
15 0.36
16 0.37
17 0.43
18 0.52
19 0.59
20 0.62
21 0.65
22 0.69
23 0.66
24 0.72
25 0.67
26 0.62
27 0.56
28 0.5
29 0.43
30 0.37
31 0.3
32 0.22
33 0.25
34 0.21
35 0.21
36 0.19
37 0.21
38 0.23
39 0.24
40 0.31
41 0.34
42 0.43
43 0.48
44 0.56
45 0.61
46 0.68
47 0.76
48 0.78
49 0.82
50 0.82
51 0.8
52 0.78
53 0.73
54 0.7
55 0.68
56 0.61
57 0.56
58 0.5
59 0.43
60 0.38
61 0.34
62 0.29
63 0.23
64 0.29
65 0.26
66 0.26
67 0.25
68 0.27
69 0.31
70 0.3
71 0.3
72 0.28
73 0.36
74 0.4
75 0.49
76 0.53
77 0.54
78 0.61
79 0.66
80 0.71
81 0.72
82 0.74