Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5FW26

Protein Details
Accession C5FW26    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27GSSLVEKKRKRASDRPERPSKKPAIDBasic
59-82TLPLNTYMRRRQQRIKHIENTNLSHydrophilic
NLS Segment(s)
PositionSequence
8-24KKRKRASDRPERPSKKP
449-480KGGKAEAASKRIARLKIPVEFPKVSRGRMSRK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009668  RNA_pol-assoc_fac_A49-like  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF06870  RNA_pol_I_A49  
Amino Acid Sequences MGSSLVEKKRKRASDRPERPSKKPAIDSNAAPAKVRFMNNEAGHVPIIASSPGLTVPETLPLNTYMRRRQQRIKHIENTNLSSTELLLHTSGHPKLNFTGREGENELDNLLNHYVAVYDPKENTVQLLEARKMMVRGCPRAAIVDVEEDTDEESAPTALSQRAALAAAFGTKLARKAVAAITENALTSNASASSAKAAESALLSSMPQDAMTIAAAEKSAQEEIQASKPLPQPNLSATQPADVYSIESLVPNGLPTLRKIPVQDWQAAVAASEGITTTSRFVANRVEAAVQSGDKTIVQLLRFILILIEFSRSLKRSSGGGRGPDSKKLPPREDLRRLLSKAVDSETSTTPTITDPFLDSIRRKFVPQGSFLSRNDITLLHTTICAMSLHIPPASGKTGGGSASELATDPSDLRDDLRLENDTILKYFRELGCRVDKPRETEFAKWSIKGGKAEAASKRIARLKIPVEFPKVSRGRMSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.88
4 0.89
5 0.87
6 0.85
7 0.84
8 0.82
9 0.8
10 0.77
11 0.76
12 0.73
13 0.72
14 0.67
15 0.66
16 0.64
17 0.56
18 0.49
19 0.4
20 0.37
21 0.37
22 0.38
23 0.32
24 0.28
25 0.37
26 0.37
27 0.41
28 0.36
29 0.32
30 0.3
31 0.26
32 0.22
33 0.14
34 0.14
35 0.09
36 0.09
37 0.07
38 0.07
39 0.08
40 0.09
41 0.08
42 0.09
43 0.09
44 0.15
45 0.15
46 0.15
47 0.16
48 0.18
49 0.21
50 0.24
51 0.3
52 0.33
53 0.43
54 0.52
55 0.58
56 0.65
57 0.72
58 0.78
59 0.82
60 0.83
61 0.82
62 0.79
63 0.81
64 0.77
65 0.72
66 0.64
67 0.54
68 0.45
69 0.36
70 0.29
71 0.23
72 0.17
73 0.14
74 0.1
75 0.11
76 0.12
77 0.18
78 0.2
79 0.23
80 0.23
81 0.24
82 0.27
83 0.34
84 0.33
85 0.31
86 0.37
87 0.32
88 0.37
89 0.37
90 0.34
91 0.28
92 0.26
93 0.24
94 0.16
95 0.15
96 0.13
97 0.1
98 0.09
99 0.08
100 0.07
101 0.07
102 0.07
103 0.1
104 0.1
105 0.12
106 0.13
107 0.15
108 0.16
109 0.16
110 0.17
111 0.14
112 0.14
113 0.15
114 0.19
115 0.18
116 0.18
117 0.19
118 0.19
119 0.19
120 0.18
121 0.21
122 0.23
123 0.26
124 0.27
125 0.28
126 0.27
127 0.27
128 0.27
129 0.22
130 0.17
131 0.15
132 0.13
133 0.12
134 0.12
135 0.11
136 0.1
137 0.09
138 0.08
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.06
145 0.06
146 0.07
147 0.07
148 0.07
149 0.07
150 0.08
151 0.07
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.08
160 0.08
161 0.08
162 0.08
163 0.1
164 0.12
165 0.15
166 0.16
167 0.16
168 0.16
169 0.16
170 0.16
171 0.14
172 0.12
173 0.08
174 0.07
175 0.06
176 0.05
177 0.06
178 0.06
179 0.06
180 0.07
181 0.08
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.05
189 0.05
190 0.05
191 0.05
192 0.06
193 0.05
194 0.05
195 0.05
196 0.04
197 0.04
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.05
207 0.05
208 0.05
209 0.06
210 0.08
211 0.11
212 0.12
213 0.11
214 0.16
215 0.21
216 0.23
217 0.23
218 0.23
219 0.22
220 0.23
221 0.27
222 0.22
223 0.2
224 0.18
225 0.18
226 0.16
227 0.15
228 0.13
229 0.09
230 0.09
231 0.07
232 0.07
233 0.06
234 0.06
235 0.05
236 0.05
237 0.05
238 0.04
239 0.04
240 0.05
241 0.06
242 0.07
243 0.11
244 0.12
245 0.14
246 0.15
247 0.16
248 0.22
249 0.24
250 0.25
251 0.21
252 0.21
253 0.2
254 0.19
255 0.17
256 0.11
257 0.08
258 0.05
259 0.05
260 0.04
261 0.04
262 0.04
263 0.05
264 0.05
265 0.06
266 0.08
267 0.08
268 0.09
269 0.12
270 0.13
271 0.13
272 0.14
273 0.13
274 0.12
275 0.14
276 0.13
277 0.09
278 0.09
279 0.09
280 0.08
281 0.07
282 0.07
283 0.08
284 0.1
285 0.1
286 0.11
287 0.11
288 0.11
289 0.11
290 0.11
291 0.09
292 0.06
293 0.07
294 0.06
295 0.07
296 0.07
297 0.08
298 0.11
299 0.12
300 0.14
301 0.14
302 0.15
303 0.17
304 0.21
305 0.28
306 0.29
307 0.31
308 0.33
309 0.41
310 0.41
311 0.44
312 0.44
313 0.42
314 0.47
315 0.5
316 0.51
317 0.49
318 0.55
319 0.59
320 0.65
321 0.64
322 0.63
323 0.63
324 0.61
325 0.57
326 0.5
327 0.42
328 0.35
329 0.31
330 0.26
331 0.19
332 0.21
333 0.2
334 0.21
335 0.2
336 0.17
337 0.16
338 0.15
339 0.16
340 0.12
341 0.12
342 0.11
343 0.12
344 0.14
345 0.18
346 0.2
347 0.23
348 0.29
349 0.29
350 0.28
351 0.32
352 0.38
353 0.38
354 0.4
355 0.43
356 0.44
357 0.48
358 0.48
359 0.49
360 0.41
361 0.37
362 0.34
363 0.27
364 0.23
365 0.2
366 0.21
367 0.15
368 0.15
369 0.15
370 0.14
371 0.14
372 0.11
373 0.09
374 0.11
375 0.13
376 0.15
377 0.15
378 0.15
379 0.14
380 0.18
381 0.19
382 0.16
383 0.14
384 0.13
385 0.14
386 0.14
387 0.14
388 0.12
389 0.1
390 0.1
391 0.1
392 0.09
393 0.09
394 0.09
395 0.09
396 0.08
397 0.09
398 0.1
399 0.1
400 0.12
401 0.15
402 0.17
403 0.18
404 0.22
405 0.23
406 0.22
407 0.25
408 0.26
409 0.23
410 0.22
411 0.22
412 0.18
413 0.17
414 0.22
415 0.22
416 0.26
417 0.26
418 0.31
419 0.39
420 0.45
421 0.48
422 0.52
423 0.54
424 0.54
425 0.58
426 0.6
427 0.55
428 0.54
429 0.55
430 0.54
431 0.54
432 0.48
433 0.47
434 0.45
435 0.46
436 0.43
437 0.4
438 0.36
439 0.35
440 0.42
441 0.43
442 0.41
443 0.41
444 0.4
445 0.44
446 0.45
447 0.45
448 0.41
449 0.45
450 0.48
451 0.5
452 0.56
453 0.56
454 0.57
455 0.58
456 0.56
457 0.58
458 0.55
459 0.51
460 0.52