Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KH96

Protein Details
Accession A0A5C3KH96    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MPKDSAKPKRKAAEKAEKAPRATASRSKKDKDPNKPKRALSHydrophilic
NLS Segment(s)
PositionSequence
6-38AKPKRKAAEKAEKAPRATASRSKKDKDPNKPKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKDSAKPKRKAAEKAEKAPRATASRSKKDKDPNKPKRALSAYMFFSQDWRERIKAENPDAGFGEVGKLLGAKWKELDEEEKKPYVELANKDKERAENEKNAYDKVGKKSRANSGSGEEDEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.84
4 0.8
5 0.73
6 0.67
7 0.62
8 0.55
9 0.51
10 0.51
11 0.5
12 0.55
13 0.61
14 0.61
15 0.63
16 0.69
17 0.74
18 0.76
19 0.77
20 0.78
21 0.81
22 0.85
23 0.79
24 0.77
25 0.72
26 0.66
27 0.58
28 0.53
29 0.46
30 0.41
31 0.41
32 0.31
33 0.27
34 0.25
35 0.25
36 0.21
37 0.2
38 0.19
39 0.19
40 0.23
41 0.27
42 0.31
43 0.3
44 0.33
45 0.3
46 0.3
47 0.29
48 0.26
49 0.2
50 0.13
51 0.11
52 0.06
53 0.06
54 0.04
55 0.04
56 0.03
57 0.08
58 0.08
59 0.08
60 0.09
61 0.1
62 0.11
63 0.12
64 0.19
65 0.21
66 0.25
67 0.28
68 0.3
69 0.29
70 0.28
71 0.28
72 0.25
73 0.26
74 0.27
75 0.32
76 0.4
77 0.4
78 0.42
79 0.43
80 0.42
81 0.42
82 0.44
83 0.41
84 0.4
85 0.44
86 0.48
87 0.48
88 0.45
89 0.43
90 0.41
91 0.41
92 0.42
93 0.47
94 0.47
95 0.51
96 0.57
97 0.64
98 0.63
99 0.6
100 0.54
101 0.5
102 0.5
103 0.46
104 0.42