Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KYK9

Protein Details
Accession A0A5C3KYK9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
501-527QEEPPVKTRSARRPPSRRLVRHVLRARHydrophilic
NLS Segment(s)
PositionSequence
512-517RRPPSR
Subcellular Location(s) plas 17, E.R. 5, cyto 2, mito 1, cyto_nucl 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002123  Plipid/glycerol_acylTrfase  
Gene Ontology GO:0016020  C:membrane  
GO:0016746  F:acyltransferase activity  
Pfam View protein in Pfam  
PF01553  Acyltransferase  
CDD cd07992  LPLAT_AAK14816-like  
Amino Acid Sequences MSSPSDVMVLHRIIRFLADLATQSFFTEIRVIGGENVPQDGPIIVTATHHNMMLDPVILSAAFPHRRKLNYWSKAGLFKNPVVAWILYSSGNIPVDRKSKDRQKLFEGTFKAMSKGNAVALFPEGTSYTEPRIMQVKDGAAWAALEYFKYKDAHPELADQPDVKVIPAAIVYTNKSKYRSSVVMEFGQPISAAYYKDQFFSGEENASRNAVKSLTRKIESELVEATINAPDWDTLYAARMAKDLLWEGKPKTDLAEFVPISQTLVDIFSNPEVVPNFVSIRRHLLTYYSLLQSTNLTNSVLSSLPLPRSLDPNTPTPTPGRLLTLLIMIKDSFAALIGLPFFFLPLLVHIPVYIMGRLGARLVEDEEETQAQNKVAFGLLSSLLIYPTIFYFLWSLFLYTPIGAVLSAGLVYLFAVYHTKMIDGNYERAKRFVAAWRILVGVWTPKRSDLPMGALSQFATPKTPPPNPWVEKPRVGPTVKEEEASTKDIPRTTSLTDLKLQEEPPVKTRSARRPPSRRLVRHVLRARVEAVNALASLFDQLEQGGPAKKIKVSTHLARVYGGKIVPSQSQQDPNEHGVTTPSVEGYRTAKEIVTFLKERGAKIPTLRHGRYEGDWATAAAAAQVGSSEAEGYSTNEEGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.16
4 0.16
5 0.13
6 0.13
7 0.15
8 0.17
9 0.16
10 0.15
11 0.15
12 0.13
13 0.14
14 0.14
15 0.12
16 0.12
17 0.13
18 0.13
19 0.15
20 0.17
21 0.18
22 0.16
23 0.17
24 0.16
25 0.15
26 0.15
27 0.12
28 0.11
29 0.09
30 0.1
31 0.08
32 0.1
33 0.13
34 0.17
35 0.17
36 0.17
37 0.17
38 0.16
39 0.17
40 0.16
41 0.14
42 0.09
43 0.08
44 0.08
45 0.08
46 0.07
47 0.09
48 0.16
49 0.23
50 0.24
51 0.31
52 0.37
53 0.4
54 0.44
55 0.51
56 0.54
57 0.54
58 0.59
59 0.58
60 0.56
61 0.62
62 0.6
63 0.58
64 0.52
65 0.46
66 0.47
67 0.41
68 0.38
69 0.33
70 0.31
71 0.24
72 0.2
73 0.2
74 0.13
75 0.14
76 0.13
77 0.14
78 0.15
79 0.15
80 0.15
81 0.2
82 0.26
83 0.29
84 0.33
85 0.39
86 0.47
87 0.56
88 0.64
89 0.63
90 0.65
91 0.71
92 0.71
93 0.69
94 0.63
95 0.57
96 0.54
97 0.49
98 0.43
99 0.35
100 0.32
101 0.27
102 0.24
103 0.23
104 0.19
105 0.18
106 0.17
107 0.16
108 0.16
109 0.13
110 0.12
111 0.1
112 0.1
113 0.13
114 0.13
115 0.14
116 0.18
117 0.18
118 0.19
119 0.25
120 0.24
121 0.24
122 0.26
123 0.24
124 0.21
125 0.22
126 0.2
127 0.13
128 0.13
129 0.1
130 0.09
131 0.07
132 0.07
133 0.08
134 0.09
135 0.12
136 0.13
137 0.14
138 0.21
139 0.25
140 0.29
141 0.29
142 0.34
143 0.33
144 0.35
145 0.36
146 0.28
147 0.24
148 0.22
149 0.21
150 0.15
151 0.13
152 0.09
153 0.09
154 0.08
155 0.09
156 0.08
157 0.09
158 0.12
159 0.17
160 0.21
161 0.24
162 0.26
163 0.27
164 0.28
165 0.32
166 0.34
167 0.33
168 0.35
169 0.36
170 0.36
171 0.36
172 0.34
173 0.28
174 0.24
175 0.19
176 0.14
177 0.12
178 0.1
179 0.1
180 0.1
181 0.14
182 0.15
183 0.16
184 0.16
185 0.15
186 0.14
187 0.16
188 0.17
189 0.15
190 0.16
191 0.16
192 0.17
193 0.17
194 0.17
195 0.14
196 0.13
197 0.12
198 0.16
199 0.19
200 0.26
201 0.31
202 0.33
203 0.33
204 0.34
205 0.39
206 0.36
207 0.34
208 0.26
209 0.21
210 0.19
211 0.19
212 0.17
213 0.11
214 0.09
215 0.07
216 0.07
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.07
223 0.1
224 0.1
225 0.11
226 0.1
227 0.1
228 0.1
229 0.11
230 0.11
231 0.11
232 0.13
233 0.16
234 0.16
235 0.19
236 0.19
237 0.18
238 0.19
239 0.17
240 0.16
241 0.15
242 0.22
243 0.19
244 0.19
245 0.2
246 0.17
247 0.17
248 0.15
249 0.13
250 0.05
251 0.07
252 0.06
253 0.06
254 0.06
255 0.06
256 0.07
257 0.07
258 0.09
259 0.08
260 0.09
261 0.09
262 0.09
263 0.11
264 0.12
265 0.13
266 0.12
267 0.17
268 0.17
269 0.17
270 0.16
271 0.16
272 0.16
273 0.18
274 0.2
275 0.15
276 0.15
277 0.14
278 0.15
279 0.14
280 0.13
281 0.11
282 0.09
283 0.08
284 0.08
285 0.08
286 0.09
287 0.08
288 0.07
289 0.07
290 0.08
291 0.09
292 0.11
293 0.12
294 0.11
295 0.15
296 0.17
297 0.2
298 0.21
299 0.25
300 0.27
301 0.26
302 0.26
303 0.24
304 0.23
305 0.2
306 0.18
307 0.15
308 0.13
309 0.13
310 0.12
311 0.13
312 0.12
313 0.1
314 0.1
315 0.08
316 0.08
317 0.07
318 0.06
319 0.04
320 0.03
321 0.04
322 0.03
323 0.03
324 0.04
325 0.04
326 0.04
327 0.04
328 0.04
329 0.03
330 0.04
331 0.03
332 0.04
333 0.06
334 0.06
335 0.06
336 0.06
337 0.07
338 0.08
339 0.08
340 0.07
341 0.05
342 0.06
343 0.06
344 0.06
345 0.06
346 0.05
347 0.05
348 0.05
349 0.06
350 0.06
351 0.06
352 0.07
353 0.08
354 0.08
355 0.08
356 0.09
357 0.09
358 0.09
359 0.09
360 0.08
361 0.08
362 0.07
363 0.07
364 0.06
365 0.06
366 0.06
367 0.06
368 0.06
369 0.06
370 0.06
371 0.06
372 0.06
373 0.04
374 0.04
375 0.07
376 0.06
377 0.07
378 0.08
379 0.08
380 0.1
381 0.1
382 0.11
383 0.09
384 0.1
385 0.1
386 0.09
387 0.09
388 0.06
389 0.06
390 0.05
391 0.05
392 0.03
393 0.03
394 0.03
395 0.03
396 0.02
397 0.02
398 0.02
399 0.03
400 0.02
401 0.03
402 0.04
403 0.05
404 0.06
405 0.06
406 0.07
407 0.08
408 0.08
409 0.14
410 0.16
411 0.21
412 0.27
413 0.31
414 0.31
415 0.31
416 0.31
417 0.26
418 0.26
419 0.29
420 0.3
421 0.28
422 0.28
423 0.28
424 0.28
425 0.27
426 0.24
427 0.18
428 0.18
429 0.18
430 0.19
431 0.18
432 0.19
433 0.21
434 0.22
435 0.24
436 0.18
437 0.21
438 0.22
439 0.24
440 0.22
441 0.21
442 0.2
443 0.19
444 0.18
445 0.13
446 0.13
447 0.11
448 0.17
449 0.24
450 0.28
451 0.29
452 0.34
453 0.44
454 0.45
455 0.53
456 0.56
457 0.55
458 0.56
459 0.57
460 0.58
461 0.56
462 0.53
463 0.46
464 0.44
465 0.46
466 0.41
467 0.38
468 0.32
469 0.28
470 0.31
471 0.33
472 0.29
473 0.24
474 0.26
475 0.27
476 0.28
477 0.27
478 0.27
479 0.24
480 0.31
481 0.3
482 0.31
483 0.33
484 0.34
485 0.33
486 0.33
487 0.31
488 0.3
489 0.33
490 0.32
491 0.33
492 0.35
493 0.34
494 0.36
495 0.45
496 0.49
497 0.54
498 0.62
499 0.68
500 0.74
501 0.82
502 0.87
503 0.89
504 0.85
505 0.83
506 0.83
507 0.8
508 0.8
509 0.79
510 0.76
511 0.69
512 0.64
513 0.59
514 0.5
515 0.43
516 0.34
517 0.26
518 0.19
519 0.16
520 0.13
521 0.09
522 0.07
523 0.08
524 0.07
525 0.06
526 0.05
527 0.06
528 0.06
529 0.07
530 0.1
531 0.13
532 0.14
533 0.17
534 0.19
535 0.21
536 0.25
537 0.27
538 0.32
539 0.37
540 0.42
541 0.49
542 0.51
543 0.49
544 0.46
545 0.45
546 0.39
547 0.35
548 0.29
549 0.21
550 0.19
551 0.21
552 0.23
553 0.24
554 0.28
555 0.29
556 0.37
557 0.38
558 0.41
559 0.43
560 0.44
561 0.43
562 0.38
563 0.33
564 0.26
565 0.26
566 0.22
567 0.18
568 0.15
569 0.13
570 0.13
571 0.16
572 0.17
573 0.19
574 0.19
575 0.19
576 0.19
577 0.2
578 0.22
579 0.23
580 0.27
581 0.26
582 0.25
583 0.31
584 0.32
585 0.33
586 0.36
587 0.35
588 0.32
589 0.36
590 0.44
591 0.46
592 0.54
593 0.54
594 0.52
595 0.53
596 0.53
597 0.5
598 0.49
599 0.41
600 0.35
601 0.33
602 0.29
603 0.26
604 0.22
605 0.2
606 0.12
607 0.11
608 0.07
609 0.06
610 0.06
611 0.06
612 0.06
613 0.06
614 0.06
615 0.06
616 0.07
617 0.08
618 0.1
619 0.12