Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KFL6

Protein Details
Accession A0A5C3KFL6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-47PTSWRTSSASYKRPRSPDRDETRHydrophilic
NLS Segment(s)
PositionSequence
316-347KSRWERAQKAKAKSKAGAEPIDRKEVMLRRSK
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036420  BRCT_dom_sf  
IPR013939  Regulatory_Dfp1/Him1  
IPR006572  Znf_DBF  
IPR038545  Znf_DBF_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF08630  Dfp1_Him1_M  
PF07535  zf-DBF  
PROSITE View protein in PROSITE  
PS51265  ZF_DBF4  
CDD cd00027  BRCT  
Amino Acid Sequences MTSTSSRRILSARSLQGPSASAGHPTSWRTSSASYKRPRSPDRDETRATSKRIRSVSISASQSTQRDIKKDKSTEREQQKLEFKEKYSKAFPNWSFYLDIENIAARECVQDVLIHRIEQLGGKVEDFFSRNITHLITDRPAPQLEETKENNPNPKLSHSKIHNKSPFKPKSKYVVGNQQFRCSNEVVFKAASYGIKIWNTTKLDSVLMRCLEVPSCFVAPQPKSAPAPTRQLERLLTKEKTHGPSDRDPLQKRHDYRYFNKASFFVLIEDLREEVATIAFHEYPPTKEQKGKVPWPILYCHPRARGPFIPFDDREKSRWERAQKAKAKSKAGAEPIDRKEVMLRRSKKQAQLHLENMGDLRRSVSLNNLHKRHAQDQELECDPEAPESANASGFLISGTGPGYMAASGNSVGVTSTTGTTSTASGSLLRNVHLPSAMDGLLKRQVLTSRKFPASSKERKPGNMDPPLVIPDRPVLRKSKSTNTLKLPKREEGTKPGYCESCRVKFEDFKTHVVSSKHRRFAQNDSNFVQLDAILDRIQRRPLSELAKAKSQQIIACRKRCTRMVMMVCEMRNGNNKRGLPCSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.46
4 0.43
5 0.36
6 0.3
7 0.24
8 0.2
9 0.2
10 0.21
11 0.23
12 0.25
13 0.28
14 0.26
15 0.27
16 0.28
17 0.31
18 0.39
19 0.45
20 0.51
21 0.56
22 0.63
23 0.7
24 0.76
25 0.8
26 0.79
27 0.79
28 0.8
29 0.8
30 0.79
31 0.75
32 0.71
33 0.72
34 0.7
35 0.66
36 0.64
37 0.61
38 0.61
39 0.6
40 0.57
41 0.53
42 0.52
43 0.53
44 0.51
45 0.49
46 0.42
47 0.41
48 0.42
49 0.38
50 0.36
51 0.36
52 0.32
53 0.37
54 0.42
55 0.48
56 0.53
57 0.61
58 0.65
59 0.68
60 0.73
61 0.76
62 0.79
63 0.79
64 0.72
65 0.72
66 0.72
67 0.69
68 0.68
69 0.63
70 0.57
71 0.58
72 0.59
73 0.57
74 0.56
75 0.55
76 0.54
77 0.59
78 0.57
79 0.54
80 0.52
81 0.48
82 0.42
83 0.36
84 0.36
85 0.27
86 0.25
87 0.18
88 0.18
89 0.15
90 0.14
91 0.14
92 0.08
93 0.09
94 0.09
95 0.08
96 0.08
97 0.1
98 0.11
99 0.19
100 0.2
101 0.19
102 0.18
103 0.19
104 0.19
105 0.18
106 0.17
107 0.15
108 0.14
109 0.14
110 0.15
111 0.15
112 0.17
113 0.17
114 0.17
115 0.15
116 0.15
117 0.16
118 0.17
119 0.17
120 0.16
121 0.16
122 0.19
123 0.18
124 0.2
125 0.21
126 0.22
127 0.22
128 0.22
129 0.22
130 0.27
131 0.28
132 0.32
133 0.33
134 0.37
135 0.44
136 0.46
137 0.51
138 0.45
139 0.46
140 0.41
141 0.44
142 0.45
143 0.4
144 0.46
145 0.46
146 0.55
147 0.58
148 0.66
149 0.68
150 0.67
151 0.72
152 0.75
153 0.77
154 0.74
155 0.72
156 0.68
157 0.68
158 0.71
159 0.69
160 0.64
161 0.66
162 0.65
163 0.7
164 0.65
165 0.63
166 0.56
167 0.51
168 0.48
169 0.38
170 0.32
171 0.27
172 0.27
173 0.23
174 0.2
175 0.19
176 0.16
177 0.17
178 0.15
179 0.12
180 0.12
181 0.13
182 0.14
183 0.16
184 0.16
185 0.21
186 0.23
187 0.23
188 0.23
189 0.21
190 0.22
191 0.22
192 0.23
193 0.2
194 0.18
195 0.18
196 0.16
197 0.16
198 0.15
199 0.14
200 0.14
201 0.11
202 0.11
203 0.11
204 0.12
205 0.18
206 0.17
207 0.22
208 0.23
209 0.24
210 0.25
211 0.28
212 0.32
213 0.29
214 0.36
215 0.33
216 0.36
217 0.33
218 0.35
219 0.35
220 0.34
221 0.35
222 0.34
223 0.34
224 0.3
225 0.34
226 0.37
227 0.38
228 0.38
229 0.37
230 0.36
231 0.4
232 0.44
233 0.47
234 0.49
235 0.48
236 0.5
237 0.53
238 0.54
239 0.52
240 0.56
241 0.55
242 0.54
243 0.55
244 0.59
245 0.58
246 0.51
247 0.5
248 0.42
249 0.36
250 0.3
251 0.26
252 0.17
253 0.13
254 0.12
255 0.11
256 0.1
257 0.09
258 0.08
259 0.07
260 0.06
261 0.04
262 0.05
263 0.04
264 0.04
265 0.06
266 0.06
267 0.06
268 0.08
269 0.09
270 0.1
271 0.13
272 0.17
273 0.17
274 0.21
275 0.23
276 0.31
277 0.37
278 0.4
279 0.44
280 0.43
281 0.44
282 0.42
283 0.42
284 0.39
285 0.37
286 0.35
287 0.33
288 0.33
289 0.33
290 0.33
291 0.37
292 0.37
293 0.35
294 0.36
295 0.35
296 0.37
297 0.35
298 0.39
299 0.38
300 0.34
301 0.33
302 0.33
303 0.34
304 0.35
305 0.4
306 0.41
307 0.45
308 0.52
309 0.61
310 0.63
311 0.68
312 0.7
313 0.71
314 0.69
315 0.62
316 0.58
317 0.53
318 0.49
319 0.45
320 0.4
321 0.42
322 0.4
323 0.41
324 0.36
325 0.31
326 0.32
327 0.32
328 0.34
329 0.36
330 0.38
331 0.39
332 0.48
333 0.54
334 0.57
335 0.59
336 0.62
337 0.61
338 0.63
339 0.61
340 0.56
341 0.5
342 0.42
343 0.36
344 0.28
345 0.2
346 0.13
347 0.11
348 0.08
349 0.09
350 0.09
351 0.14
352 0.22
353 0.3
354 0.39
355 0.4
356 0.41
357 0.45
358 0.49
359 0.49
360 0.47
361 0.41
362 0.41
363 0.41
364 0.43
365 0.41
366 0.38
367 0.31
368 0.26
369 0.23
370 0.16
371 0.14
372 0.09
373 0.08
374 0.08
375 0.09
376 0.08
377 0.08
378 0.08
379 0.08
380 0.07
381 0.06
382 0.05
383 0.05
384 0.05
385 0.05
386 0.05
387 0.04
388 0.04
389 0.05
390 0.05
391 0.05
392 0.05
393 0.05
394 0.05
395 0.05
396 0.05
397 0.05
398 0.05
399 0.05
400 0.05
401 0.05
402 0.06
403 0.06
404 0.06
405 0.07
406 0.08
407 0.08
408 0.08
409 0.08
410 0.08
411 0.1
412 0.11
413 0.14
414 0.15
415 0.15
416 0.17
417 0.17
418 0.17
419 0.16
420 0.16
421 0.13
422 0.14
423 0.14
424 0.12
425 0.12
426 0.14
427 0.18
428 0.17
429 0.16
430 0.16
431 0.22
432 0.27
433 0.32
434 0.36
435 0.39
436 0.42
437 0.44
438 0.43
439 0.47
440 0.5
441 0.56
442 0.57
443 0.59
444 0.6
445 0.62
446 0.69
447 0.68
448 0.68
449 0.66
450 0.59
451 0.51
452 0.48
453 0.48
454 0.42
455 0.33
456 0.24
457 0.22
458 0.26
459 0.28
460 0.29
461 0.32
462 0.36
463 0.44
464 0.49
465 0.54
466 0.58
467 0.63
468 0.68
469 0.71
470 0.76
471 0.75
472 0.78
473 0.74
474 0.71
475 0.67
476 0.66
477 0.62
478 0.61
479 0.62
480 0.58
481 0.55
482 0.53
483 0.52
484 0.46
485 0.48
486 0.46
487 0.46
488 0.44
489 0.44
490 0.45
491 0.48
492 0.52
493 0.55
494 0.52
495 0.49
496 0.51
497 0.5
498 0.5
499 0.46
500 0.5
501 0.51
502 0.57
503 0.6
504 0.61
505 0.66
506 0.65
507 0.72
508 0.73
509 0.71
510 0.67
511 0.61
512 0.59
513 0.52
514 0.48
515 0.38
516 0.27
517 0.2
518 0.14
519 0.13
520 0.11
521 0.13
522 0.16
523 0.2
524 0.26
525 0.26
526 0.28
527 0.31
528 0.36
529 0.4
530 0.45
531 0.5
532 0.48
533 0.55
534 0.53
535 0.53
536 0.5
537 0.48
538 0.42
539 0.43
540 0.5
541 0.51
542 0.57
543 0.61
544 0.63
545 0.67
546 0.69
547 0.68
548 0.65
549 0.65
550 0.66
551 0.65
552 0.65
553 0.64
554 0.59
555 0.55
556 0.48
557 0.42
558 0.44
559 0.42
560 0.43
561 0.45
562 0.49
563 0.5