Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KRV3

Protein Details
Accession A0A5C3KRV3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
113-134KTEKRDKEAKKAKPATRQNIPSHydrophilic
NLS Segment(s)
PositionSequence
59-77HKKGITEEVAKKRSRRTVK
110-150AKAKTEKRDKEAKKAKPATRQNIPSGPKVSKQQMKGGKAGR
Subcellular Location(s) nucl 11cyto 11cyto_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MKVEIDSFSGYRIYPSKGKLFVRGDSKVFRFAGSKSASLFLQRKNPRKIAWTVVYRRMHKKGITEEVAKKRSRRTVKHQRGIVGADLGAIQAKRNQTAAVRTQQRLAAIAKAKTEKRDKEAKKAKPATRQNIPSGPKVSKQQMKGGKAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.33
4 0.39
5 0.41
6 0.46
7 0.47
8 0.48
9 0.51
10 0.5
11 0.47
12 0.47
13 0.47
14 0.44
15 0.4
16 0.35
17 0.3
18 0.27
19 0.31
20 0.27
21 0.26
22 0.22
23 0.23
24 0.22
25 0.26
26 0.29
27 0.26
28 0.33
29 0.41
30 0.49
31 0.54
32 0.58
33 0.54
34 0.56
35 0.56
36 0.53
37 0.51
38 0.51
39 0.49
40 0.53
41 0.57
42 0.57
43 0.6
44 0.57
45 0.53
46 0.47
47 0.47
48 0.44
49 0.44
50 0.43
51 0.42
52 0.45
53 0.49
54 0.53
55 0.5
56 0.46
57 0.45
58 0.49
59 0.53
60 0.51
61 0.54
62 0.6
63 0.68
64 0.74
65 0.71
66 0.65
67 0.58
68 0.53
69 0.43
70 0.32
71 0.21
72 0.13
73 0.1
74 0.08
75 0.07
76 0.05
77 0.05
78 0.08
79 0.09
80 0.09
81 0.1
82 0.11
83 0.12
84 0.17
85 0.22
86 0.27
87 0.33
88 0.33
89 0.34
90 0.35
91 0.33
92 0.31
93 0.27
94 0.24
95 0.23
96 0.24
97 0.25
98 0.3
99 0.32
100 0.37
101 0.44
102 0.44
103 0.45
104 0.55
105 0.55
106 0.61
107 0.68
108 0.7
109 0.72
110 0.77
111 0.78
112 0.78
113 0.83
114 0.81
115 0.81
116 0.78
117 0.74
118 0.73
119 0.7
120 0.66
121 0.61
122 0.56
123 0.51
124 0.52
125 0.55
126 0.54
127 0.54
128 0.57
129 0.61
130 0.62