Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KM14

Protein Details
Accession A0A5C3KM14    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-124GKVKTKIMQPWENRRKRKQSLDTAAKWSHydrophilic
NLS Segment(s)
PositionSequence
109-114NRRKRK
Subcellular Location(s) extr 10, plas 6, nucl 3, golg 3, mito 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MHFFLFIGFCLLWALQAVSRPIDLQRRADLVDDAVMLKRELYDLYLEAVIERRSNIQLEDISIRDPQQVNWLGPDGRHQIDGPRIHGRPGKLAQVWGKVKTKIMQPWENRRKRKQSLDTAAKWSSFHGKNGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.11
4 0.13
5 0.12
6 0.13
7 0.14
8 0.17
9 0.25
10 0.27
11 0.27
12 0.29
13 0.3
14 0.31
15 0.31
16 0.28
17 0.2
18 0.18
19 0.15
20 0.12
21 0.11
22 0.11
23 0.09
24 0.09
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.07
31 0.09
32 0.09
33 0.08
34 0.08
35 0.1
36 0.09
37 0.08
38 0.09
39 0.09
40 0.1
41 0.11
42 0.11
43 0.11
44 0.1
45 0.12
46 0.13
47 0.12
48 0.12
49 0.11
50 0.12
51 0.13
52 0.13
53 0.11
54 0.16
55 0.18
56 0.16
57 0.17
58 0.18
59 0.15
60 0.15
61 0.19
62 0.16
63 0.14
64 0.15
65 0.15
66 0.16
67 0.22
68 0.24
69 0.24
70 0.27
71 0.27
72 0.29
73 0.32
74 0.3
75 0.3
76 0.31
77 0.33
78 0.27
79 0.31
80 0.31
81 0.37
82 0.39
83 0.38
84 0.4
85 0.36
86 0.38
87 0.38
88 0.41
89 0.38
90 0.43
91 0.47
92 0.51
93 0.61
94 0.69
95 0.76
96 0.79
97 0.82
98 0.84
99 0.85
100 0.87
101 0.86
102 0.86
103 0.87
104 0.88
105 0.83
106 0.79
107 0.73
108 0.63
109 0.53
110 0.45
111 0.43
112 0.36
113 0.38