Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DLK7

Protein Details
Accession A5DLK7    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
170-192AYKNNFKVKKPANKSFKAPRIKFHydrophilic
NLS Segment(s)
PositionSequence
176-194KVKKPANKSFKAPRIKFAA
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
KEGG pgu:PGUG_04158  -  
Pfam View protein in Pfam  
PF05205  COMPASS-Shg1  
Amino Acid Sequences MAENEPPTDAKSLMSIYKRSGAFDQQRKRLLEDFKSSETHKNLLLKLQMMLDNKVKNDPSILAKNRGKMGALIQGEIVNQHSSTNDPGLLGIVDKDIQEKIIESPDFRHLIESEIKDIRRKVLGISDEDHKKMLEEEENQKLKDQEEAKRKASERAQEERDREERDRDIAYKNNFKVKKPANKSFKAPRIKFAARDGGREDDKEPRPLMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.33
5 0.33
6 0.33
7 0.34
8 0.38
9 0.44
10 0.51
11 0.58
12 0.59
13 0.66
14 0.64
15 0.65
16 0.62
17 0.59
18 0.56
19 0.55
20 0.53
21 0.49
22 0.5
23 0.49
24 0.5
25 0.45
26 0.4
27 0.36
28 0.36
29 0.33
30 0.35
31 0.34
32 0.28
33 0.26
34 0.27
35 0.27
36 0.24
37 0.26
38 0.26
39 0.26
40 0.26
41 0.29
42 0.27
43 0.23
44 0.23
45 0.22
46 0.23
47 0.29
48 0.32
49 0.38
50 0.39
51 0.42
52 0.43
53 0.41
54 0.36
55 0.27
56 0.26
57 0.23
58 0.21
59 0.18
60 0.16
61 0.16
62 0.15
63 0.15
64 0.14
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.09
71 0.09
72 0.08
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.05
79 0.04
80 0.05
81 0.05
82 0.06
83 0.05
84 0.06
85 0.06
86 0.06
87 0.07
88 0.1
89 0.1
90 0.1
91 0.12
92 0.16
93 0.17
94 0.16
95 0.16
96 0.13
97 0.15
98 0.19
99 0.18
100 0.17
101 0.19
102 0.2
103 0.22
104 0.22
105 0.22
106 0.19
107 0.18
108 0.16
109 0.18
110 0.2
111 0.19
112 0.2
113 0.25
114 0.26
115 0.26
116 0.26
117 0.2
118 0.18
119 0.17
120 0.17
121 0.15
122 0.17
123 0.22
124 0.31
125 0.34
126 0.34
127 0.35
128 0.33
129 0.29
130 0.31
131 0.31
132 0.3
133 0.37
134 0.43
135 0.44
136 0.5
137 0.51
138 0.51
139 0.52
140 0.52
141 0.49
142 0.51
143 0.55
144 0.56
145 0.57
146 0.57
147 0.56
148 0.54
149 0.5
150 0.47
151 0.42
152 0.39
153 0.39
154 0.35
155 0.35
156 0.37
157 0.41
158 0.45
159 0.46
160 0.52
161 0.52
162 0.52
163 0.57
164 0.59
165 0.63
166 0.64
167 0.71
168 0.71
169 0.74
170 0.8
171 0.81
172 0.8
173 0.8
174 0.73
175 0.69
176 0.69
177 0.68
178 0.64
179 0.6
180 0.61
181 0.52
182 0.54
183 0.52
184 0.49
185 0.47
186 0.45
187 0.41
188 0.4
189 0.43
190 0.44