Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KSS0

Protein Details
Accession A0A5C3KSS0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
134-153PPSTTKAPPKPSKKREKVALHydrophilic
NLS Segment(s)
PositionSequence
141-149PPKPSKKRE
Subcellular Location(s) mito 10, nucl 7.5, cyto_nucl 7, cyto 5.5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR018506  Cyt_B5_heme-BS  
Gene Ontology GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS00191  CYTOCHROME_B5_1  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MASYLRSWLWTGTTPATSADTVDRPEPPTIQTISPQASDDEDGSATETEQDQEDDDVAPAFPSLNSAQRLQSGPPATSTKGPTPARAFLSDSALMPPPPVPSLAVRTPGVQRKVGTASLFVPPTNPGANSLAVPPSTTKAPPKPSKKREKVALAPGHSAMDWANLKASGADLRGVDTLLRIPPSVLKQHNKRDDAWSAFYGKVYNITPYIPFHPGGEKDLMRVAGRDGTKLFATTHGWVNADFMLDACLVGFLVPEPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.21
5 0.19
6 0.2
7 0.18
8 0.2
9 0.22
10 0.23
11 0.23
12 0.26
13 0.25
14 0.23
15 0.25
16 0.26
17 0.25
18 0.25
19 0.27
20 0.28
21 0.27
22 0.26
23 0.22
24 0.21
25 0.21
26 0.19
27 0.15
28 0.13
29 0.12
30 0.13
31 0.12
32 0.1
33 0.1
34 0.1
35 0.09
36 0.1
37 0.1
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.09
44 0.08
45 0.08
46 0.07
47 0.06
48 0.05
49 0.08
50 0.09
51 0.14
52 0.16
53 0.17
54 0.18
55 0.21
56 0.23
57 0.21
58 0.26
59 0.23
60 0.21
61 0.23
62 0.25
63 0.23
64 0.25
65 0.28
66 0.25
67 0.32
68 0.32
69 0.34
70 0.35
71 0.38
72 0.36
73 0.35
74 0.34
75 0.26
76 0.29
77 0.25
78 0.21
79 0.19
80 0.18
81 0.16
82 0.14
83 0.13
84 0.1
85 0.1
86 0.1
87 0.09
88 0.09
89 0.14
90 0.16
91 0.18
92 0.18
93 0.19
94 0.24
95 0.29
96 0.3
97 0.27
98 0.26
99 0.25
100 0.27
101 0.27
102 0.22
103 0.17
104 0.16
105 0.17
106 0.17
107 0.14
108 0.12
109 0.11
110 0.12
111 0.12
112 0.1
113 0.1
114 0.11
115 0.11
116 0.11
117 0.11
118 0.1
119 0.09
120 0.1
121 0.08
122 0.08
123 0.09
124 0.1
125 0.14
126 0.19
127 0.28
128 0.36
129 0.46
130 0.56
131 0.65
132 0.75
133 0.79
134 0.81
135 0.8
136 0.79
137 0.75
138 0.74
139 0.7
140 0.61
141 0.54
142 0.47
143 0.4
144 0.31
145 0.25
146 0.15
147 0.13
148 0.11
149 0.1
150 0.1
151 0.09
152 0.09
153 0.09
154 0.1
155 0.07
156 0.07
157 0.08
158 0.08
159 0.09
160 0.09
161 0.1
162 0.09
163 0.08
164 0.09
165 0.09
166 0.1
167 0.09
168 0.09
169 0.12
170 0.16
171 0.23
172 0.28
173 0.35
174 0.43
175 0.54
176 0.62
177 0.62
178 0.61
179 0.59
180 0.6
181 0.55
182 0.51
183 0.43
184 0.37
185 0.34
186 0.32
187 0.27
188 0.2
189 0.19
190 0.16
191 0.16
192 0.14
193 0.15
194 0.16
195 0.18
196 0.21
197 0.2
198 0.2
199 0.19
200 0.24
201 0.24
202 0.26
203 0.29
204 0.25
205 0.24
206 0.27
207 0.27
208 0.22
209 0.21
210 0.2
211 0.2
212 0.21
213 0.22
214 0.19
215 0.2
216 0.2
217 0.21
218 0.2
219 0.17
220 0.2
221 0.21
222 0.25
223 0.25
224 0.25
225 0.23
226 0.24
227 0.22
228 0.19
229 0.16
230 0.11
231 0.1
232 0.1
233 0.09
234 0.07
235 0.07
236 0.06
237 0.06
238 0.06