Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3L9E2

Protein Details
Accession A0A5C3L9E2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-35APSSGGKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
4-29AKAPAPSSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAPAPSSGGKAAKKKKWSKGKVKDKAQHAVVLDKTTFDRILKEVPTFKFISQSILIERLKINGSLARVAIRHLEKEGTIKPIVHHSAQLIYTRSTTSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.58
4 0.65
5 0.7
6 0.73
7 0.78
8 0.83
9 0.85
10 0.86
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.81
17 0.71
18 0.63
19 0.53
20 0.48
21 0.38
22 0.33
23 0.26
24 0.2
25 0.19
26 0.17
27 0.16
28 0.12
29 0.12
30 0.11
31 0.14
32 0.15
33 0.16
34 0.2
35 0.19
36 0.23
37 0.23
38 0.21
39 0.22
40 0.2
41 0.22
42 0.17
43 0.18
44 0.15
45 0.19
46 0.19
47 0.17
48 0.17
49 0.15
50 0.15
51 0.14
52 0.14
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.18
61 0.17
62 0.17
63 0.17
64 0.18
65 0.17
66 0.22
67 0.23
68 0.22
69 0.22
70 0.22
71 0.22
72 0.28
73 0.32
74 0.28
75 0.27
76 0.24
77 0.27
78 0.28
79 0.3
80 0.25
81 0.23
82 0.23