Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KWL9

Protein Details
Accession A0A5C3KWL9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-38RQGGKLKPLKAPKKDKKEDTBasic
NLS Segment(s)
PositionSequence
22-36GKLKPLKAPKKDKKE
55-75LKAAREKALKHGPLVGGGIKK
Subcellular Location(s) mito 12, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MAAQQIKLFSKNYYTMASRQGGKLKPLKAPKKDKKEDTEEDAAFKAQKKADADALKAAREKALKHGPLVGGGIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.32
4 0.34
5 0.31
6 0.31
7 0.36
8 0.34
9 0.37
10 0.4
11 0.38
12 0.41
13 0.49
14 0.55
15 0.58
16 0.67
17 0.71
18 0.75
19 0.8
20 0.8
21 0.76
22 0.76
23 0.7
24 0.64
25 0.61
26 0.5
27 0.43
28 0.37
29 0.31
30 0.24
31 0.22
32 0.19
33 0.14
34 0.18
35 0.18
36 0.2
37 0.27
38 0.28
39 0.28
40 0.31
41 0.32
42 0.3
43 0.3
44 0.28
45 0.25
46 0.25
47 0.25
48 0.26
49 0.34
50 0.34
51 0.34
52 0.38
53 0.35
54 0.34
55 0.35