Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3K977

Protein Details
Accession A0A5C3K977   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
155-177AFLPRTPKLSRPPQKSPKSLPSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 11, cyto 5.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001844  Cpn60/GroEL  
IPR027413  GROEL-like_equatorial_sf  
Gene Ontology GO:0140662  F:ATP-dependent protein folding chaperone  
GO:0042026  P:protein refolding  
Amino Acid Sequences MLNEGRVKMLKGVDVLANAVSVTLGPKGQFTFICSEHESYGGPKIPKVPDFYDASNTNRTYIDGVTVAKSISLKKKFKNLGARYVFLRFSSRKPLTPNSLNSRRSLQNECSCWRRYNNCHSRRAIYSEGFKNAAAGCNPMDLRCGSQAAVDRVAAFLPRTPKLSRPPQKSPKSLPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.13
5 0.11
6 0.09
7 0.07
8 0.05
9 0.06
10 0.06
11 0.07
12 0.07
13 0.09
14 0.1
15 0.12
16 0.13
17 0.14
18 0.18
19 0.18
20 0.23
21 0.23
22 0.25
23 0.23
24 0.23
25 0.21
26 0.18
27 0.21
28 0.22
29 0.2
30 0.19
31 0.24
32 0.28
33 0.3
34 0.33
35 0.31
36 0.3
37 0.33
38 0.33
39 0.33
40 0.32
41 0.33
42 0.33
43 0.31
44 0.28
45 0.25
46 0.24
47 0.2
48 0.17
49 0.15
50 0.11
51 0.11
52 0.11
53 0.11
54 0.1
55 0.09
56 0.1
57 0.12
58 0.19
59 0.27
60 0.31
61 0.33
62 0.42
63 0.46
64 0.52
65 0.59
66 0.54
67 0.56
68 0.54
69 0.53
70 0.46
71 0.44
72 0.37
73 0.27
74 0.28
75 0.2
76 0.19
77 0.27
78 0.27
79 0.27
80 0.31
81 0.35
82 0.38
83 0.42
84 0.46
85 0.45
86 0.52
87 0.51
88 0.48
89 0.48
90 0.45
91 0.44
92 0.43
93 0.41
94 0.39
95 0.42
96 0.43
97 0.44
98 0.43
99 0.42
100 0.43
101 0.44
102 0.44
103 0.51
104 0.59
105 0.62
106 0.66
107 0.66
108 0.65
109 0.6
110 0.59
111 0.52
112 0.45
113 0.45
114 0.41
115 0.41
116 0.37
117 0.34
118 0.29
119 0.25
120 0.24
121 0.17
122 0.15
123 0.13
124 0.15
125 0.16
126 0.14
127 0.16
128 0.14
129 0.16
130 0.15
131 0.16
132 0.13
133 0.16
134 0.21
135 0.22
136 0.23
137 0.21
138 0.19
139 0.18
140 0.19
141 0.17
142 0.12
143 0.13
144 0.17
145 0.19
146 0.23
147 0.25
148 0.31
149 0.4
150 0.5
151 0.57
152 0.6
153 0.69
154 0.76
155 0.83
156 0.85
157 0.85