Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KJ98

Protein Details
Accession A0A5C3KJ98   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
230-274SKPTPASKSKPTPKSKPTPKSTPLDGSVQPKHSKRPQNQTASKLPHydrophilic
NLS Segment(s)
PositionSequence
204-250VKKKLQRLLKAMPKKQAAGTRVRTKPSKPTPASKSKPTPKSKPTPKS
Subcellular Location(s) mito 11, cyto_nucl 8, nucl 7.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006703  G_AIG1  
IPR027417  P-loop_NTPase  
IPR025662  Sigma_54_int_dom_ATP-bd_1  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF04548  AIG1  
PROSITE View protein in PROSITE  
PS00675  SIGMA54_INTERACT_1  
Amino Acid Sequences MATHQPVQKDDIVIVIVGDTGTGKSTFINKLLGKEILKVGHGLMSCTAKATHCAMDMPLEYQRFGKRLVLVDTPGFNDHATSDNEVLASIVKYLLSIWPPSGPLQFGVLYLQDLSLDRASVSSETHRMFKMLEAVFDKQYYRRVAVASTKSPVGASDARKRLEEGFSKTVRAAISSDLYKADGGNPWSALSYLMEPTPGRPLEVKKKLQRLLKAMPKKQAAGTRVRTKPSKPTPASKSKPTPKSKPTPKSTPLDGSVQPKHSKRPQNQTASKLPAAPRAPTSASQPNSPRAKASGGLGAQIRKALCFGKGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.08
4 0.07
5 0.06
6 0.05
7 0.05
8 0.07
9 0.07
10 0.07
11 0.09
12 0.14
13 0.17
14 0.18
15 0.26
16 0.25
17 0.29
18 0.32
19 0.36
20 0.32
21 0.32
22 0.34
23 0.28
24 0.27
25 0.24
26 0.21
27 0.2
28 0.19
29 0.17
30 0.16
31 0.17
32 0.16
33 0.17
34 0.18
35 0.15
36 0.18
37 0.19
38 0.18
39 0.16
40 0.18
41 0.17
42 0.19
43 0.19
44 0.18
45 0.2
46 0.18
47 0.18
48 0.21
49 0.23
50 0.21
51 0.22
52 0.24
53 0.23
54 0.26
55 0.29
56 0.28
57 0.28
58 0.28
59 0.28
60 0.26
61 0.23
62 0.2
63 0.16
64 0.14
65 0.12
66 0.13
67 0.14
68 0.14
69 0.14
70 0.14
71 0.14
72 0.13
73 0.12
74 0.1
75 0.08
76 0.06
77 0.06
78 0.05
79 0.05
80 0.06
81 0.08
82 0.08
83 0.09
84 0.09
85 0.1
86 0.12
87 0.13
88 0.14
89 0.12
90 0.11
91 0.12
92 0.12
93 0.11
94 0.11
95 0.09
96 0.09
97 0.08
98 0.07
99 0.06
100 0.06
101 0.08
102 0.07
103 0.07
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.08
110 0.13
111 0.14
112 0.16
113 0.16
114 0.16
115 0.15
116 0.15
117 0.2
118 0.16
119 0.17
120 0.18
121 0.2
122 0.2
123 0.21
124 0.21
125 0.15
126 0.19
127 0.19
128 0.17
129 0.17
130 0.16
131 0.18
132 0.24
133 0.26
134 0.23
135 0.23
136 0.21
137 0.2
138 0.19
139 0.18
140 0.15
141 0.15
142 0.18
143 0.24
144 0.29
145 0.3
146 0.3
147 0.31
148 0.29
149 0.3
150 0.3
151 0.28
152 0.29
153 0.29
154 0.3
155 0.29
156 0.29
157 0.24
158 0.21
159 0.15
160 0.1
161 0.12
162 0.12
163 0.12
164 0.1
165 0.11
166 0.1
167 0.09
168 0.09
169 0.09
170 0.11
171 0.11
172 0.11
173 0.1
174 0.11
175 0.11
176 0.1
177 0.08
178 0.08
179 0.08
180 0.07
181 0.09
182 0.08
183 0.09
184 0.14
185 0.14
186 0.13
187 0.15
188 0.22
189 0.31
190 0.4
191 0.47
192 0.49
193 0.58
194 0.63
195 0.66
196 0.66
197 0.63
198 0.63
199 0.65
200 0.67
201 0.64
202 0.65
203 0.62
204 0.58
205 0.55
206 0.52
207 0.46
208 0.46
209 0.49
210 0.51
211 0.53
212 0.57
213 0.56
214 0.53
215 0.6
216 0.6
217 0.63
218 0.58
219 0.63
220 0.66
221 0.73
222 0.75
223 0.74
224 0.75
225 0.74
226 0.79
227 0.79
228 0.8
229 0.79
230 0.84
231 0.85
232 0.85
233 0.84
234 0.83
235 0.81
236 0.78
237 0.74
238 0.69
239 0.61
240 0.56
241 0.52
242 0.5
243 0.49
244 0.49
245 0.5
246 0.47
247 0.53
248 0.57
249 0.63
250 0.64
251 0.7
252 0.73
253 0.77
254 0.82
255 0.8
256 0.8
257 0.76
258 0.69
259 0.63
260 0.56
261 0.53
262 0.48
263 0.44
264 0.38
265 0.36
266 0.37
267 0.33
268 0.38
269 0.39
270 0.39
271 0.43
272 0.45
273 0.49
274 0.53
275 0.52
276 0.48
277 0.42
278 0.43
279 0.37
280 0.35
281 0.34
282 0.28
283 0.3
284 0.31
285 0.3
286 0.28
287 0.29
288 0.27
289 0.2
290 0.22
291 0.2