Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KFI2

Protein Details
Accession A0A5C3KFI2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-70LEPWRSCHHRRPRQGLLRAQHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 11, extr 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRSHSLGLCKLTLPTIALHLGSLVGDLGLEREFVGTNIWAVIEAAEAAGLEPWRSCHHRRPRQGLLRAQHIPNQLEGTPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.12
5 0.11
6 0.1
7 0.09
8 0.08
9 0.07
10 0.05
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.05
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.03
30 0.03
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.04
38 0.04
39 0.06
40 0.1
41 0.16
42 0.2
43 0.29
44 0.41
45 0.51
46 0.61
47 0.68
48 0.75
49 0.8
50 0.84
51 0.83
52 0.77
53 0.76
54 0.72
55 0.65
56 0.6
57 0.55
58 0.48
59 0.42
60 0.4