Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KKQ4

Protein Details
Accession A0A5C3KKQ4   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
145-165EISLKTSGAAPKKKKRSNRPEHydrophilic
NLS Segment(s)
PositionSequence
153-165AAPKKKKRSNRPE
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022745  eIF4G1_eIF4E-bd  
IPR036211  eIF4G_eIF4E-bd_sf  
Pfam View protein in Pfam  
PF12152  eIF_4G1  
Amino Acid Sequences MEKALDLQSANGTNKGNLMPKETSATTSPFVSAQPLKSLDNIPYPEGVHGTERALNEVSTPVGFRYDRDFLLQFKEVCKGKPPHLNTYGLIDPLDPAALSRLRLGSRRKPAVLVQHPTEPGANPVSQSDSQNRDHGHTGKPGVSEISLKTSGAAPKKKKRSNRPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.28
4 0.24
5 0.28
6 0.27
7 0.27
8 0.32
9 0.3
10 0.3
11 0.26
12 0.28
13 0.24
14 0.23
15 0.22
16 0.18
17 0.17
18 0.19
19 0.2
20 0.18
21 0.21
22 0.22
23 0.22
24 0.24
25 0.25
26 0.23
27 0.26
28 0.26
29 0.23
30 0.22
31 0.22
32 0.2
33 0.19
34 0.17
35 0.13
36 0.12
37 0.13
38 0.14
39 0.14
40 0.15
41 0.15
42 0.14
43 0.12
44 0.12
45 0.11
46 0.08
47 0.08
48 0.07
49 0.09
50 0.09
51 0.1
52 0.14
53 0.16
54 0.16
55 0.18
56 0.19
57 0.17
58 0.21
59 0.23
60 0.19
61 0.17
62 0.23
63 0.21
64 0.2
65 0.27
66 0.26
67 0.28
68 0.36
69 0.39
70 0.4
71 0.42
72 0.44
73 0.37
74 0.38
75 0.33
76 0.26
77 0.22
78 0.15
79 0.12
80 0.1
81 0.09
82 0.04
83 0.04
84 0.06
85 0.06
86 0.07
87 0.08
88 0.1
89 0.11
90 0.17
91 0.24
92 0.3
93 0.39
94 0.43
95 0.43
96 0.43
97 0.46
98 0.5
99 0.52
100 0.49
101 0.42
102 0.42
103 0.42
104 0.4
105 0.37
106 0.27
107 0.22
108 0.19
109 0.16
110 0.12
111 0.13
112 0.17
113 0.18
114 0.2
115 0.24
116 0.26
117 0.29
118 0.33
119 0.34
120 0.32
121 0.36
122 0.37
123 0.35
124 0.35
125 0.35
126 0.33
127 0.33
128 0.3
129 0.26
130 0.24
131 0.22
132 0.18
133 0.21
134 0.19
135 0.19
136 0.19
137 0.21
138 0.26
139 0.33
140 0.41
141 0.45
142 0.55
143 0.66
144 0.74
145 0.81