Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3L1L9

Protein Details
Accession A0A5C3L1L9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-131RQQAAPRRRRGGKRGKRGGRRGRGKGRKGRKGRKGRKGRKGRKGRKYRKAVAAAPBasic
NLS Segment(s)
PositionSequence
81-126APRRRRGGKRGKRGGRRGRGKGRKGRKGRKGRKGRKGRKGRKYRKA
174-187GRGGRGGRGQRRYK
Subcellular Location(s) cyto 9, extr 7, mito 6, nucl 4
Family & Domain DBs
Amino Acid Sequences MRLSLTATFCAAVVIGSTGALGYTLDGNFADLEARNLDYDIDVRAPEYDLELDIRAPEYDFDLDARGISDEFDLEARQQAAPRRRRGGKRGKRGGRRGRGKGRKGRKGRKGRKGRKGRKGRKYRKAVAAAPSAPAGDAGAATEAPVAAPEAPAITARNLFDQELEVRRRVGVMGRGGRGGRGQRRYKYRAPPVAPPQEEAPAPGAREFFDWEDVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.06
11 0.06
12 0.07
13 0.07
14 0.08
15 0.08
16 0.08
17 0.09
18 0.07
19 0.09
20 0.09
21 0.1
22 0.1
23 0.1
24 0.1
25 0.09
26 0.1
27 0.1
28 0.1
29 0.09
30 0.09
31 0.09
32 0.1
33 0.09
34 0.1
35 0.09
36 0.09
37 0.1
38 0.1
39 0.09
40 0.09
41 0.1
42 0.08
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.1
50 0.1
51 0.09
52 0.09
53 0.08
54 0.07
55 0.07
56 0.07
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.08
64 0.08
65 0.11
66 0.18
67 0.26
68 0.33
69 0.39
70 0.46
71 0.53
72 0.59
73 0.67
74 0.71
75 0.72
76 0.76
77 0.8
78 0.82
79 0.83
80 0.87
81 0.87
82 0.86
83 0.85
84 0.83
85 0.83
86 0.83
87 0.83
88 0.82
89 0.82
90 0.81
91 0.83
92 0.83
93 0.83
94 0.85
95 0.86
96 0.87
97 0.89
98 0.89
99 0.89
100 0.91
101 0.9
102 0.89
103 0.91
104 0.91
105 0.9
106 0.91
107 0.91
108 0.9
109 0.9
110 0.87
111 0.84
112 0.8
113 0.74
114 0.67
115 0.62
116 0.52
117 0.44
118 0.36
119 0.27
120 0.2
121 0.16
122 0.1
123 0.05
124 0.04
125 0.03
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.06
140 0.07
141 0.07
142 0.09
143 0.1
144 0.12
145 0.13
146 0.13
147 0.12
148 0.13
149 0.16
150 0.21
151 0.23
152 0.22
153 0.22
154 0.21
155 0.21
156 0.2
157 0.21
158 0.2
159 0.25
160 0.29
161 0.29
162 0.32
163 0.32
164 0.32
165 0.32
166 0.35
167 0.36
168 0.4
169 0.47
170 0.53
171 0.62
172 0.69
173 0.73
174 0.75
175 0.77
176 0.78
177 0.74
178 0.76
179 0.76
180 0.8
181 0.72
182 0.64
183 0.56
184 0.5
185 0.46
186 0.38
187 0.32
188 0.24
189 0.24
190 0.23
191 0.21
192 0.18
193 0.2
194 0.22
195 0.2
196 0.22