Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KI57

Protein Details
Accession A0A5C3KI57   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-37EANSKRKLWSRVFKPFKIRRHRDEYSRDDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_nucl 8.5, nucl 6.5, mito 6, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
CDD cd00882  Ras_like_GTPase  
Amino Acid Sequences MAKNKSTDEANSKRKLWSRVFKPFKIRRHRDEYSRDDIIIPVIGLTGVGKSSFINAVTGRIDAVVGHGLKSCTQDPQAVKMTMPSYLAGRYPGLSSRNIVFIDTPGFDDTYNADDSVILRRVSSWMAKHYPQDMTVAGIVYMEDISQKRMHKSMLTNLEMFQRMCGRESFHNVALVTTQWDTVLLNEKARNLALEREQELRLKVWKEFIDRGAVLVLGFQRTLWMVYQWYSIGLCFCPAVTFERPEFWCRGAGQWRSAVDQLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.66
4 0.66
5 0.67
6 0.72
7 0.78
8 0.78
9 0.82
10 0.82
11 0.83
12 0.83
13 0.83
14 0.81
15 0.81
16 0.82
17 0.8
18 0.8
19 0.78
20 0.74
21 0.67
22 0.59
23 0.5
24 0.43
25 0.35
26 0.26
27 0.18
28 0.1
29 0.08
30 0.07
31 0.06
32 0.06
33 0.05
34 0.04
35 0.04
36 0.05
37 0.05
38 0.07
39 0.08
40 0.09
41 0.1
42 0.1
43 0.13
44 0.13
45 0.13
46 0.12
47 0.1
48 0.1
49 0.07
50 0.09
51 0.1
52 0.09
53 0.1
54 0.12
55 0.12
56 0.14
57 0.17
58 0.16
59 0.15
60 0.17
61 0.22
62 0.21
63 0.27
64 0.31
65 0.28
66 0.28
67 0.28
68 0.27
69 0.22
70 0.21
71 0.16
72 0.11
73 0.12
74 0.12
75 0.11
76 0.11
77 0.1
78 0.1
79 0.13
80 0.14
81 0.14
82 0.15
83 0.15
84 0.18
85 0.17
86 0.16
87 0.13
88 0.12
89 0.13
90 0.12
91 0.12
92 0.09
93 0.1
94 0.09
95 0.09
96 0.09
97 0.1
98 0.1
99 0.09
100 0.08
101 0.08
102 0.09
103 0.12
104 0.13
105 0.11
106 0.1
107 0.11
108 0.12
109 0.13
110 0.15
111 0.13
112 0.15
113 0.18
114 0.2
115 0.22
116 0.23
117 0.22
118 0.2
119 0.2
120 0.15
121 0.13
122 0.12
123 0.1
124 0.07
125 0.07
126 0.06
127 0.04
128 0.04
129 0.03
130 0.05
131 0.05
132 0.07
133 0.11
134 0.12
135 0.14
136 0.16
137 0.17
138 0.19
139 0.22
140 0.28
141 0.32
142 0.33
143 0.31
144 0.31
145 0.33
146 0.31
147 0.28
148 0.21
149 0.17
150 0.16
151 0.16
152 0.16
153 0.16
154 0.18
155 0.24
156 0.27
157 0.25
158 0.27
159 0.25
160 0.24
161 0.22
162 0.19
163 0.14
164 0.11
165 0.1
166 0.07
167 0.07
168 0.07
169 0.08
170 0.15
171 0.14
172 0.17
173 0.18
174 0.19
175 0.2
176 0.2
177 0.2
178 0.14
179 0.17
180 0.19
181 0.22
182 0.23
183 0.25
184 0.27
185 0.28
186 0.28
187 0.26
188 0.27
189 0.25
190 0.24
191 0.27
192 0.29
193 0.31
194 0.34
195 0.33
196 0.33
197 0.31
198 0.31
199 0.25
200 0.22
201 0.16
202 0.15
203 0.14
204 0.09
205 0.09
206 0.08
207 0.08
208 0.09
209 0.1
210 0.09
211 0.1
212 0.1
213 0.12
214 0.14
215 0.13
216 0.13
217 0.13
218 0.12
219 0.12
220 0.11
221 0.11
222 0.09
223 0.09
224 0.09
225 0.1
226 0.15
227 0.17
228 0.22
229 0.22
230 0.29
231 0.32
232 0.35
233 0.37
234 0.33
235 0.33
236 0.3
237 0.36
238 0.38
239 0.4
240 0.4
241 0.42
242 0.43
243 0.42
244 0.45