Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3L2T7

Protein Details
Accession A0A5C3L2T7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-59FYDHWNKGKQWKDIRHKYATHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, E.R. 5, mito 3, golg 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MGIGNALYHGIFKRNSVFVTTVFVGAFTFGIGFDTGVTKFYDHWNKGKQWKDIRHKYATEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.21
5 0.18
6 0.22
7 0.21
8 0.18
9 0.15
10 0.15
11 0.11
12 0.1
13 0.1
14 0.05
15 0.04
16 0.03
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.06
24 0.07
25 0.07
26 0.08
27 0.15
28 0.24
29 0.26
30 0.33
31 0.38
32 0.45
33 0.53
34 0.6
35 0.61
36 0.63
37 0.7
38 0.75
39 0.79
40 0.8
41 0.79