Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KQT1

Protein Details
Accession A0A5C3KQT1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-98QKGVEYQPSQRKRKRKHGFLARKRSAGBasic
NLS Segment(s)
PositionSequence
82-112RKRKRKHGFLARKRSAGGRRTLARRLAKGRR
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRFLQLLARLPRLIPAAVASRSSSRTVQTCISSTFKTFYSPLLSSRSLPRPAFSLSPSPVLGALIQARSIQKGVEYQPSQRKRKRKHGFLARKRSAGGRRTLARRLAKGRRYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.2
3 0.17
4 0.19
5 0.19
6 0.21
7 0.19
8 0.2
9 0.22
10 0.24
11 0.23
12 0.21
13 0.23
14 0.25
15 0.26
16 0.26
17 0.25
18 0.26
19 0.28
20 0.26
21 0.25
22 0.24
23 0.21
24 0.21
25 0.19
26 0.17
27 0.19
28 0.19
29 0.19
30 0.22
31 0.23
32 0.22
33 0.27
34 0.31
35 0.32
36 0.31
37 0.29
38 0.27
39 0.28
40 0.28
41 0.24
42 0.23
43 0.18
44 0.2
45 0.2
46 0.17
47 0.15
48 0.14
49 0.12
50 0.08
51 0.08
52 0.06
53 0.06
54 0.08
55 0.08
56 0.09
57 0.09
58 0.08
59 0.07
60 0.1
61 0.12
62 0.19
63 0.21
64 0.27
65 0.36
66 0.46
67 0.55
68 0.59
69 0.67
70 0.69
71 0.78
72 0.83
73 0.83
74 0.85
75 0.87
76 0.91
77 0.91
78 0.93
79 0.88
80 0.8
81 0.71
82 0.68
83 0.64
84 0.59
85 0.56
86 0.53
87 0.54
88 0.58
89 0.62
90 0.64
91 0.63
92 0.64
93 0.67
94 0.69
95 0.68
96 0.72