Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KDV4

Protein Details
Accession A0A5C3KDV4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-116GGMAERKQRKSDRQQAIRDRNFMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSILHLALRSSLAGTVCRRYSSTVASGTSTGTSTESSKKKAATPQSSCPPDTLLKGLNYLKGQPPVLALSDDQYPDWLWNILKPKEYPDDGPGGMAERKQRKSDRQQAIRDRNFMSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.23
4 0.25
5 0.25
6 0.27
7 0.29
8 0.29
9 0.3
10 0.27
11 0.27
12 0.26
13 0.26
14 0.22
15 0.2
16 0.16
17 0.13
18 0.1
19 0.1
20 0.11
21 0.18
22 0.21
23 0.24
24 0.26
25 0.27
26 0.3
27 0.36
28 0.44
29 0.45
30 0.48
31 0.52
32 0.58
33 0.59
34 0.56
35 0.49
36 0.42
37 0.34
38 0.3
39 0.24
40 0.18
41 0.15
42 0.18
43 0.18
44 0.18
45 0.17
46 0.18
47 0.18
48 0.18
49 0.18
50 0.14
51 0.15
52 0.13
53 0.13
54 0.12
55 0.09
56 0.09
57 0.1
58 0.1
59 0.09
60 0.09
61 0.09
62 0.08
63 0.09
64 0.09
65 0.08
66 0.11
67 0.19
68 0.2
69 0.24
70 0.24
71 0.27
72 0.31
73 0.34
74 0.32
75 0.28
76 0.3
77 0.27
78 0.27
79 0.22
80 0.2
81 0.19
82 0.19
83 0.24
84 0.28
85 0.33
86 0.4
87 0.47
88 0.54
89 0.64
90 0.73
91 0.75
92 0.76
93 0.82
94 0.86
95 0.9
96 0.86
97 0.8
98 0.72