Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KD58

Protein Details
Accession A0A5C3KD58    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21FNLARRRDRYRTSRSSRTSRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences FNLARRRDRYRTSRSSRTSRSTSGSSITTTNRPTLHMPKPQRKAQRAPRVVSSPAPAFFCLLESSLHPLAPNPAPKPVLKPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.79
4 0.77
5 0.73
6 0.66
7 0.62
8 0.55
9 0.48
10 0.41
11 0.35
12 0.29
13 0.26
14 0.25
15 0.24
16 0.22
17 0.23
18 0.21
19 0.22
20 0.25
21 0.3
22 0.33
23 0.38
24 0.45
25 0.52
26 0.58
27 0.62
28 0.67
29 0.65
30 0.69
31 0.7
32 0.73
33 0.7
34 0.66
35 0.64
36 0.59
37 0.55
38 0.47
39 0.4
40 0.31
41 0.27
42 0.26
43 0.21
44 0.18
45 0.16
46 0.16
47 0.12
48 0.11
49 0.1
50 0.09
51 0.15
52 0.15
53 0.15
54 0.14
55 0.14
56 0.19
57 0.23
58 0.29
59 0.25
60 0.3
61 0.32
62 0.33
63 0.4