Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KKC3

Protein Details
Accession A0A5C3KKC3    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-84LTGFHKRKKAKADAAREKAKEREKEGRKEDRRERRKQLRERAIENBasic
178-229APVPTVQKKAPRSKPTKSKSKPKKIFYESKDERKREKDKQYTRKREKAALAGHydrophilic
NLS Segment(s)
PositionSequence
44-79HKRKKAKADAAREKAKEREKEGRKEDRRERRKQLRE
185-240KKAPRSKPTKSKSKPKKIFYESKDERKREKDKQYTRKREKAALAGNKAIKKQKTRR
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences MRTNIAELTQSHKAIAAKKRARVAEVKEVLFDDEARHEFLTGFHKRKKAKADAAREKAKEREKEGRKEDRRERRKQLRERAIENAAEVERAYGAIISQLSLAYFRRSGNRGVLLEADNDDSDNEWDGIGGNDEQDEEYEGEQVVATVTVVEDFDPTTLTTGPRPTPQESSEHAKPSLAPVPTVQKKAPRSKPTKSKSKPKKIFYESKDERKREKDKQYTRKREKAALAGNKAIKKQKTRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.45
4 0.47
5 0.52
6 0.59
7 0.58
8 0.59
9 0.59
10 0.57
11 0.57
12 0.56
13 0.51
14 0.45
15 0.43
16 0.4
17 0.33
18 0.27
19 0.18
20 0.16
21 0.17
22 0.18
23 0.17
24 0.16
25 0.16
26 0.18
27 0.24
28 0.28
29 0.34
30 0.37
31 0.44
32 0.48
33 0.54
34 0.61
35 0.62
36 0.64
37 0.67
38 0.72
39 0.76
40 0.81
41 0.82
42 0.76
43 0.7
44 0.68
45 0.66
46 0.6
47 0.56
48 0.58
49 0.58
50 0.65
51 0.7
52 0.73
53 0.73
54 0.78
55 0.81
56 0.82
57 0.83
58 0.84
59 0.86
60 0.85
61 0.88
62 0.88
63 0.89
64 0.88
65 0.84
66 0.78
67 0.73
68 0.66
69 0.55
70 0.46
71 0.37
72 0.26
73 0.2
74 0.16
75 0.11
76 0.07
77 0.07
78 0.06
79 0.04
80 0.03
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.06
88 0.06
89 0.07
90 0.08
91 0.09
92 0.13
93 0.15
94 0.16
95 0.18
96 0.22
97 0.2
98 0.2
99 0.21
100 0.17
101 0.16
102 0.15
103 0.13
104 0.09
105 0.08
106 0.07
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.06
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.06
144 0.07
145 0.08
146 0.09
147 0.13
148 0.15
149 0.18
150 0.22
151 0.24
152 0.27
153 0.28
154 0.31
155 0.32
156 0.38
157 0.38
158 0.38
159 0.35
160 0.31
161 0.3
162 0.3
163 0.31
164 0.24
165 0.2
166 0.19
167 0.28
168 0.33
169 0.37
170 0.35
171 0.37
172 0.45
173 0.55
174 0.62
175 0.63
176 0.66
177 0.72
178 0.81
179 0.82
180 0.85
181 0.84
182 0.85
183 0.86
184 0.9
185 0.89
186 0.87
187 0.89
188 0.87
189 0.88
190 0.81
191 0.81
192 0.79
193 0.8
194 0.81
195 0.77
196 0.76
197 0.75
198 0.79
199 0.78
200 0.81
201 0.81
202 0.82
203 0.87
204 0.9
205 0.92
206 0.93
207 0.93
208 0.88
209 0.85
210 0.81
211 0.79
212 0.78
213 0.76
214 0.71
215 0.69
216 0.7
217 0.65
218 0.65
219 0.63
220 0.6