Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KYC6

Protein Details
Accession A0A5C3KYC6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-71GRRASARRTGRTRYRRYQHRYBasic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 4, extr 4, vacu 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSVFSAIGRGINAIISAIANVFMTIISAVTYILVSIFDVITDILCCRCFGRRASARRTGRTRYRRYQHRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.04
6 0.05
7 0.04
8 0.04
9 0.04
10 0.03
11 0.04
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.05
32 0.06
33 0.06
34 0.07
35 0.11
36 0.14
37 0.16
38 0.26
39 0.34
40 0.42
41 0.49
42 0.58
43 0.62
44 0.68
45 0.73
46 0.71
47 0.74
48 0.77
49 0.79
50 0.79
51 0.83