Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KEH3

Protein Details
Accession A0A5C3KEH3    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
87-113DKNLCRFSNRAYKKRFKRLVKEGQSAFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 12.666, nucl 7.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR003545  Telomerase_RT  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0003721  F:telomerase RNA reverse transcriptase activity  
Amino Acid Sequences MKMNEYIREGGLKVKGNPAFLFKTIQNTIEFSYSSIISQASRKTKNNRNQVSWSPKKLAVLWLGSHAFHHVLSKKPREYAAILRTLDKNLCRFSNRAYKKRFKRLVKEGQSAFNHTNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.35
4 0.35
5 0.35
6 0.33
7 0.3
8 0.32
9 0.24
10 0.29
11 0.28
12 0.29
13 0.25
14 0.24
15 0.24
16 0.22
17 0.21
18 0.15
19 0.15
20 0.13
21 0.12
22 0.1
23 0.09
24 0.09
25 0.12
26 0.17
27 0.23
28 0.28
29 0.34
30 0.42
31 0.51
32 0.59
33 0.67
34 0.67
35 0.65
36 0.66
37 0.68
38 0.7
39 0.66
40 0.61
41 0.53
42 0.48
43 0.44
44 0.39
45 0.33
46 0.26
47 0.21
48 0.18
49 0.17
50 0.17
51 0.16
52 0.15
53 0.13
54 0.11
55 0.09
56 0.12
57 0.12
58 0.18
59 0.25
60 0.32
61 0.33
62 0.34
63 0.35
64 0.35
65 0.36
66 0.38
67 0.36
68 0.36
69 0.35
70 0.36
71 0.36
72 0.35
73 0.34
74 0.29
75 0.28
76 0.25
77 0.28
78 0.28
79 0.29
80 0.33
81 0.41
82 0.48
83 0.53
84 0.59
85 0.66
86 0.73
87 0.82
88 0.86
89 0.85
90 0.86
91 0.87
92 0.89
93 0.88
94 0.87
95 0.79
96 0.78
97 0.72
98 0.68