Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KFT3

Protein Details
Accession A0A5C3KFT3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-50MNIKHNKNFKSNRAPEHRKKHPPPNQPDLKQHydrophilic
NLS Segment(s)
PositionSequence
33-39APEHRKK
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MPRLSLSEHQLLYLLLHIFMNIKHNKNFKSNRAPEHRKKHPPPNQPDLKQVLEALGIKIRDFAHDPSVLKAKGWRPQQRQPTPPGHAKDKTLKRKATELFDQTPHGSSNMLTRQDMEPVLLAKADTVTLLSREATLVPVLSQKDAFTFISPAQGNKALHNQTNMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.11
3 0.1
4 0.1
5 0.11
6 0.12
7 0.2
8 0.23
9 0.27
10 0.32
11 0.39
12 0.43
13 0.52
14 0.59
15 0.6
16 0.64
17 0.67
18 0.71
19 0.75
20 0.82
21 0.82
22 0.84
23 0.85
24 0.85
25 0.86
26 0.88
27 0.87
28 0.87
29 0.85
30 0.85
31 0.85
32 0.77
33 0.75
34 0.69
35 0.6
36 0.5
37 0.42
38 0.32
39 0.24
40 0.21
41 0.15
42 0.13
43 0.12
44 0.11
45 0.13
46 0.13
47 0.13
48 0.15
49 0.15
50 0.16
51 0.19
52 0.2
53 0.19
54 0.24
55 0.22
56 0.2
57 0.23
58 0.23
59 0.27
60 0.36
61 0.43
62 0.45
63 0.53
64 0.64
65 0.66
66 0.67
67 0.67
68 0.64
69 0.59
70 0.59
71 0.54
72 0.5
73 0.44
74 0.43
75 0.46
76 0.49
77 0.55
78 0.56
79 0.56
80 0.52
81 0.58
82 0.58
83 0.54
84 0.51
85 0.46
86 0.42
87 0.4
88 0.4
89 0.34
90 0.31
91 0.26
92 0.2
93 0.14
94 0.11
95 0.15
96 0.19
97 0.2
98 0.18
99 0.2
100 0.2
101 0.22
102 0.22
103 0.17
104 0.12
105 0.11
106 0.12
107 0.1
108 0.09
109 0.07
110 0.07
111 0.06
112 0.05
113 0.05
114 0.06
115 0.07
116 0.08
117 0.08
118 0.08
119 0.08
120 0.09
121 0.09
122 0.09
123 0.08
124 0.08
125 0.12
126 0.13
127 0.14
128 0.14
129 0.13
130 0.14
131 0.17
132 0.17
133 0.15
134 0.16
135 0.15
136 0.22
137 0.22
138 0.22
139 0.24
140 0.29
141 0.28
142 0.29
143 0.38
144 0.36
145 0.39