Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3LE66

Protein Details
Accession A0A5C3LE66    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-50AISLKSPPVRGKPRVFKDKKAFQYNWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
Amino Acid Sequences MLSRCARSSAPRLASQIHSTSTTSAISLKSPPVRGKPRVFKDKKAFQYNWYTKVLETSKAAPLLVLHHNDFTAERLKKLRSDITVAAHRVLKSTPSLSSPTPAPETQLPTLTVVRSSIFGVALRDFGLEQASLEKMINSQNGSFAVLQIPSMNPPLIQAVLRAMDRSVPPKRPKTEDEIKAEEAAKHADPDQPGRRMKRVRQVRVPELKVMGAIIEGRVFLPPGLKDVSTLPTLDTLRAQIVGLLSAPAAQLAGVLSQAAGGQLARTLEGLKKGLEDEQAAEKADGDTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.44
4 0.37
5 0.34
6 0.31
7 0.29
8 0.27
9 0.23
10 0.18
11 0.17
12 0.16
13 0.15
14 0.17
15 0.22
16 0.26
17 0.31
18 0.36
19 0.44
20 0.52
21 0.59
22 0.66
23 0.7
24 0.74
25 0.81
26 0.8
27 0.81
28 0.82
29 0.83
30 0.83
31 0.82
32 0.74
33 0.69
34 0.74
35 0.71
36 0.66
37 0.59
38 0.5
39 0.41
40 0.46
41 0.42
42 0.34
43 0.3
44 0.28
45 0.28
46 0.28
47 0.28
48 0.2
49 0.19
50 0.2
51 0.22
52 0.22
53 0.19
54 0.19
55 0.19
56 0.2
57 0.19
58 0.17
59 0.21
60 0.19
61 0.21
62 0.24
63 0.27
64 0.29
65 0.33
66 0.36
67 0.3
68 0.34
69 0.34
70 0.36
71 0.4
72 0.38
73 0.35
74 0.33
75 0.3
76 0.26
77 0.24
78 0.19
79 0.16
80 0.16
81 0.15
82 0.15
83 0.18
84 0.17
85 0.19
86 0.18
87 0.19
88 0.21
89 0.2
90 0.2
91 0.2
92 0.24
93 0.23
94 0.24
95 0.22
96 0.2
97 0.21
98 0.19
99 0.16
100 0.12
101 0.11
102 0.1
103 0.1
104 0.08
105 0.08
106 0.08
107 0.09
108 0.08
109 0.08
110 0.08
111 0.07
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.08
124 0.09
125 0.09
126 0.09
127 0.09
128 0.1
129 0.11
130 0.1
131 0.09
132 0.08
133 0.07
134 0.07
135 0.07
136 0.07
137 0.06
138 0.07
139 0.07
140 0.06
141 0.06
142 0.07
143 0.07
144 0.07
145 0.06
146 0.06
147 0.08
148 0.08
149 0.08
150 0.07
151 0.09
152 0.1
153 0.16
154 0.2
155 0.27
156 0.34
157 0.41
158 0.46
159 0.49
160 0.51
161 0.53
162 0.58
163 0.57
164 0.57
165 0.54
166 0.51
167 0.47
168 0.45
169 0.37
170 0.28
171 0.24
172 0.17
173 0.13
174 0.13
175 0.14
176 0.15
177 0.22
178 0.27
179 0.31
180 0.37
181 0.4
182 0.47
183 0.51
184 0.56
185 0.59
186 0.64
187 0.65
188 0.69
189 0.74
190 0.75
191 0.78
192 0.74
193 0.66
194 0.57
195 0.49
196 0.39
197 0.31
198 0.21
199 0.11
200 0.09
201 0.06
202 0.05
203 0.05
204 0.06
205 0.06
206 0.06
207 0.06
208 0.08
209 0.08
210 0.11
211 0.13
212 0.12
213 0.13
214 0.15
215 0.18
216 0.16
217 0.16
218 0.14
219 0.17
220 0.18
221 0.17
222 0.16
223 0.15
224 0.14
225 0.15
226 0.14
227 0.11
228 0.1
229 0.1
230 0.09
231 0.08
232 0.07
233 0.07
234 0.07
235 0.05
236 0.05
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.05
246 0.04
247 0.04
248 0.04
249 0.04
250 0.06
251 0.07
252 0.07
253 0.08
254 0.1
255 0.12
256 0.17
257 0.18
258 0.17
259 0.18
260 0.19
261 0.21
262 0.22
263 0.21
264 0.2
265 0.24
266 0.25
267 0.26
268 0.24
269 0.22
270 0.2