Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KIX9

Protein Details
Accession A0A5C3KIX9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
123-143AKQHRFKQRKGKRTSSRTPFSHydrophilic
NLS Segment(s)
PositionSequence
80-88NRKSSLKRR
128-135FKQRKGKR
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 6.5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036424  UPP_synth-like_sf  
Gene Ontology GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0019408  P:dolichol biosynthetic process  
Amino Acid Sequences MVFPFNPYDRDIRCHLLEMSKDSTIDSDSSESEIEYRPLTPPPSDYSDSRPISPSQNTNPTIPLVKIVLSDSSNAKERPNRKSSLKRRTRGMEQGSTSASLTVCLMSHVASKSAIAAAASSLAKQHRFKQRKGKRTSSRTPFSLGVSEFEAMLEGEHGLSPPDFMIVHSFDAEDTHRRVPLELINFPPWHIRLTEIYQSRLGHIIGWPWKAPKSLCTAFPLDDISFREALDEFSGAEFRFGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.36
4 0.36
5 0.37
6 0.36
7 0.32
8 0.3
9 0.27
10 0.26
11 0.22
12 0.19
13 0.16
14 0.13
15 0.13
16 0.14
17 0.14
18 0.13
19 0.13
20 0.14
21 0.14
22 0.13
23 0.13
24 0.13
25 0.17
26 0.19
27 0.19
28 0.2
29 0.23
30 0.29
31 0.31
32 0.32
33 0.35
34 0.42
35 0.43
36 0.42
37 0.39
38 0.35
39 0.37
40 0.39
41 0.39
42 0.36
43 0.43
44 0.43
45 0.42
46 0.41
47 0.37
48 0.35
49 0.29
50 0.24
51 0.16
52 0.14
53 0.13
54 0.13
55 0.13
56 0.12
57 0.13
58 0.13
59 0.15
60 0.19
61 0.19
62 0.21
63 0.26
64 0.32
65 0.39
66 0.43
67 0.46
68 0.51
69 0.61
70 0.68
71 0.73
72 0.76
73 0.72
74 0.74
75 0.74
76 0.72
77 0.7
78 0.66
79 0.61
80 0.52
81 0.5
82 0.43
83 0.38
84 0.31
85 0.23
86 0.16
87 0.1
88 0.09
89 0.07
90 0.06
91 0.05
92 0.06
93 0.05
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.07
100 0.07
101 0.07
102 0.04
103 0.04
104 0.03
105 0.05
106 0.05
107 0.05
108 0.07
109 0.08
110 0.12
111 0.14
112 0.21
113 0.3
114 0.36
115 0.42
116 0.52
117 0.6
118 0.66
119 0.73
120 0.77
121 0.76
122 0.79
123 0.83
124 0.81
125 0.77
126 0.68
127 0.64
128 0.55
129 0.46
130 0.4
131 0.3
132 0.22
133 0.18
134 0.17
135 0.13
136 0.11
137 0.1
138 0.07
139 0.06
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.04
149 0.05
150 0.05
151 0.05
152 0.08
153 0.09
154 0.1
155 0.1
156 0.1
157 0.09
158 0.11
159 0.12
160 0.13
161 0.15
162 0.16
163 0.18
164 0.18
165 0.19
166 0.2
167 0.23
168 0.25
169 0.25
170 0.27
171 0.3
172 0.3
173 0.3
174 0.32
175 0.27
176 0.23
177 0.2
178 0.19
179 0.18
180 0.23
181 0.31
182 0.3
183 0.31
184 0.34
185 0.34
186 0.33
187 0.31
188 0.26
189 0.19
190 0.17
191 0.21
192 0.22
193 0.25
194 0.25
195 0.26
196 0.28
197 0.31
198 0.31
199 0.28
200 0.32
201 0.33
202 0.34
203 0.37
204 0.37
205 0.35
206 0.35
207 0.35
208 0.27
209 0.26
210 0.26
211 0.25
212 0.22
213 0.21
214 0.21
215 0.17
216 0.18
217 0.17
218 0.14
219 0.11
220 0.12
221 0.14
222 0.13