Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DC36

Protein Details
Accession A5DC36   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-72ISQKTPKLPKSQKHEKVEPKSVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007275  YTH_domain  
IPR045168  YTH_prot  
Gene Ontology GO:0003723  F:RNA binding  
KEGG pgu:PGUG_00841  -  
Pfam View protein in Pfam  
PF04146  YTH  
PROSITE View protein in PROSITE  
PS50882  YTH  
CDD cd21134  YTH  
Amino Acid Sequences MFSIDSLLLSKLGPFPDMAHSMYETKRNIWSCHFRSEYPSQRLTENSSQISQKTPKLPKSQKHEKVEPKSVSGLSLDRIPPNSRFFIIKSFTEKDVASSVEHGVWTSTDLGNKRLDKAYKTTSEDGGKVYLFFSVNGSGRFCGIAEMTAAVNFKSKLNIWNETSRWSGVFPITWVSTDSLPNRHFVQLRNPLNENKPITYSRDTQEVPFNIAFKFIAIYAKCDIYKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.19
4 0.22
5 0.21
6 0.19
7 0.21
8 0.24
9 0.26
10 0.31
11 0.27
12 0.27
13 0.33
14 0.35
15 0.36
16 0.41
17 0.49
18 0.46
19 0.54
20 0.54
21 0.48
22 0.51
23 0.58
24 0.6
25 0.56
26 0.57
27 0.48
28 0.47
29 0.48
30 0.49
31 0.46
32 0.41
33 0.37
34 0.35
35 0.36
36 0.35
37 0.38
38 0.35
39 0.34
40 0.38
41 0.43
42 0.47
43 0.56
44 0.64
45 0.66
46 0.71
47 0.77
48 0.78
49 0.79
50 0.81
51 0.8
52 0.8
53 0.82
54 0.74
55 0.65
56 0.58
57 0.5
58 0.41
59 0.32
60 0.25
61 0.16
62 0.18
63 0.17
64 0.15
65 0.18
66 0.19
67 0.21
68 0.24
69 0.24
70 0.22
71 0.22
72 0.21
73 0.24
74 0.25
75 0.23
76 0.26
77 0.27
78 0.26
79 0.27
80 0.26
81 0.22
82 0.2
83 0.19
84 0.13
85 0.12
86 0.12
87 0.1
88 0.1
89 0.08
90 0.07
91 0.06
92 0.07
93 0.07
94 0.07
95 0.09
96 0.1
97 0.12
98 0.17
99 0.17
100 0.18
101 0.2
102 0.21
103 0.21
104 0.25
105 0.28
106 0.28
107 0.32
108 0.32
109 0.31
110 0.32
111 0.3
112 0.26
113 0.22
114 0.18
115 0.13
116 0.12
117 0.1
118 0.08
119 0.08
120 0.08
121 0.1
122 0.11
123 0.12
124 0.13
125 0.11
126 0.11
127 0.11
128 0.1
129 0.08
130 0.07
131 0.06
132 0.05
133 0.06
134 0.06
135 0.07
136 0.07
137 0.06
138 0.08
139 0.09
140 0.09
141 0.1
142 0.11
143 0.16
144 0.21
145 0.26
146 0.28
147 0.34
148 0.34
149 0.36
150 0.37
151 0.31
152 0.27
153 0.23
154 0.21
155 0.15
156 0.15
157 0.12
158 0.13
159 0.13
160 0.13
161 0.14
162 0.13
163 0.14
164 0.18
165 0.2
166 0.24
167 0.24
168 0.26
169 0.27
170 0.3
171 0.32
172 0.3
173 0.37
174 0.41
175 0.47
176 0.5
177 0.51
178 0.52
179 0.53
180 0.58
181 0.52
182 0.43
183 0.41
184 0.38
185 0.41
186 0.4
187 0.41
188 0.35
189 0.39
190 0.38
191 0.37
192 0.43
193 0.38
194 0.39
195 0.35
196 0.34
197 0.27
198 0.27
199 0.24
200 0.16
201 0.16
202 0.11
203 0.17
204 0.16
205 0.2
206 0.21
207 0.25
208 0.27