Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X6M2

Protein Details
Accession A0A4T0X6M2   
Localization Confidence High
Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNSDRIVRREKRRRGAGTREVDLHydrophilic
77-108DKGDSSVKYDKRRKTKRKSKSIKIKYSRVPSNHydrophilic
NLS Segment(s)
PositionSequence
9-14REKRRR
87-102KRRKTKRKSKSIKIKY
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
Amino Acid Sequences MNSDRIVRREKRRRGAGTREVDLDDIKIGPLPELQPRIEEAQQRVIEQHKKIVQARIKIYQNENKKESVNLYESNTDKGDSSVKYDKRRKTKRKSKSIKIKYSRVPSNKVKLIYIDVIKMMIQEYLKDKRINEYLVKKFDERGKEMMKEYIERIDDYFSTLIDLRLSNSLIKTDLDKIAAEKNKLRANIYDVRKERSDVGLELKSVRTEFKEVKDKLNSEEKLYKQLLSLKNGDEKVDEGNIVEELSHNIDCSYNKNKTLKLLQQINEILKVTSGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.87
4 0.83
5 0.77
6 0.69
7 0.6
8 0.52
9 0.43
10 0.33
11 0.24
12 0.17
13 0.13
14 0.12
15 0.11
16 0.11
17 0.13
18 0.14
19 0.19
20 0.23
21 0.23
22 0.22
23 0.25
24 0.29
25 0.31
26 0.34
27 0.31
28 0.36
29 0.37
30 0.36
31 0.36
32 0.39
33 0.42
34 0.38
35 0.42
36 0.37
37 0.43
38 0.46
39 0.52
40 0.51
41 0.52
42 0.55
43 0.56
44 0.57
45 0.56
46 0.59
47 0.58
48 0.62
49 0.62
50 0.59
51 0.53
52 0.49
53 0.46
54 0.41
55 0.39
56 0.33
57 0.28
58 0.28
59 0.31
60 0.3
61 0.31
62 0.28
63 0.23
64 0.2
65 0.18
66 0.19
67 0.14
68 0.2
69 0.26
70 0.31
71 0.41
72 0.49
73 0.56
74 0.63
75 0.74
76 0.79
77 0.81
78 0.86
79 0.87
80 0.9
81 0.93
82 0.92
83 0.93
84 0.93
85 0.92
86 0.89
87 0.87
88 0.83
89 0.81
90 0.79
91 0.73
92 0.7
93 0.66
94 0.66
95 0.62
96 0.56
97 0.48
98 0.4
99 0.37
100 0.33
101 0.27
102 0.19
103 0.15
104 0.14
105 0.13
106 0.12
107 0.09
108 0.07
109 0.06
110 0.07
111 0.11
112 0.15
113 0.19
114 0.21
115 0.2
116 0.23
117 0.26
118 0.27
119 0.29
120 0.33
121 0.35
122 0.37
123 0.39
124 0.35
125 0.36
126 0.37
127 0.36
128 0.3
129 0.3
130 0.29
131 0.3
132 0.3
133 0.3
134 0.27
135 0.24
136 0.22
137 0.2
138 0.18
139 0.16
140 0.15
141 0.14
142 0.13
143 0.13
144 0.13
145 0.09
146 0.09
147 0.09
148 0.09
149 0.08
150 0.09
151 0.08
152 0.09
153 0.1
154 0.1
155 0.09
156 0.1
157 0.1
158 0.1
159 0.11
160 0.12
161 0.13
162 0.13
163 0.13
164 0.13
165 0.2
166 0.23
167 0.24
168 0.24
169 0.29
170 0.32
171 0.33
172 0.34
173 0.28
174 0.31
175 0.37
176 0.39
177 0.42
178 0.41
179 0.43
180 0.43
181 0.43
182 0.39
183 0.33
184 0.31
185 0.23
186 0.26
187 0.24
188 0.23
189 0.23
190 0.22
191 0.2
192 0.18
193 0.18
194 0.15
195 0.19
196 0.22
197 0.27
198 0.37
199 0.37
200 0.44
201 0.49
202 0.48
203 0.48
204 0.54
205 0.48
206 0.44
207 0.5
208 0.44
209 0.45
210 0.45
211 0.4
212 0.33
213 0.41
214 0.4
215 0.37
216 0.4
217 0.35
218 0.41
219 0.41
220 0.39
221 0.32
222 0.28
223 0.25
224 0.23
225 0.19
226 0.13
227 0.13
228 0.12
229 0.11
230 0.1
231 0.08
232 0.08
233 0.12
234 0.11
235 0.11
236 0.11
237 0.13
238 0.14
239 0.2
240 0.26
241 0.29
242 0.36
243 0.41
244 0.43
245 0.48
246 0.57
247 0.58
248 0.6
249 0.63
250 0.59
251 0.62
252 0.65
253 0.6
254 0.54
255 0.47
256 0.37