Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0WY67

Protein Details
Accession A0A4T0WY67   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRKTYCKGKQCRKHTQHRVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKQCRKHTQHRVTQYKAGKASLYSQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVACKTKLQLSLKRCKHFELGGDKKQKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.91
5 0.89
6 0.91
7 0.91
8 0.9
9 0.89
10 0.89
11 0.88
12 0.81
13 0.8
14 0.74
15 0.69
16 0.61
17 0.52
18 0.42
19 0.34
20 0.33
21 0.34
22 0.35
23 0.32
24 0.37
25 0.44
26 0.48
27 0.54
28 0.57
29 0.57
30 0.61
31 0.67
32 0.66
33 0.66
34 0.64
35 0.63
36 0.62
37 0.6
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.66
57 0.6
58 0.57
59 0.54
60 0.48
61 0.42
62 0.38
63 0.31
64 0.27
65 0.25
66 0.25
67 0.29
68 0.35
69 0.39
70 0.44
71 0.54
72 0.62
73 0.66
74 0.64
75 0.6
76 0.58
77 0.53
78 0.53
79 0.53
80 0.53
81 0.55
82 0.62
83 0.59
84 0.56
85 0.55
86 0.49