Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X5W7

Protein Details
Accession A0A4T0X5W7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-66AIGIGAKSRKKKQQQQRPSINKVGVHydrophilic
NLS Segment(s)
PositionSequence
50-52RKK
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR024621  Mba1  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0032979  P:protein insertion into mitochondrial inner membrane from matrix  
Pfam View protein in Pfam  
PF07961  MBA1  
Amino Acid Sequences MFTRTVTPGVTFLRSNVFLNLRGTSLRYASTSELITKKEDSAIGIGAKSRKKKQQQQRPSINKVGVPHDPYIPVSYNHLSFSQPRLSLRALWSRLKLFAFNWVQVYQFKSGMGKGYKPQFVQWKNSAIKQFVQVNKAFSERKIETIRPYVSEFVYFQLGKRQAALPKALIHWELVKFNQSPKLISFNAFPHEDGSTLLCQIIYKFDTKQKWIVKKAGDSDFTETERDMVEYLAFNIDPYNDNVALAGSVFESPLERNLESKMVSSQSKALEYMNTNGDIYRTEPTDEVKMLQYKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.27
5 0.27
6 0.29
7 0.29
8 0.24
9 0.23
10 0.24
11 0.21
12 0.2
13 0.19
14 0.17
15 0.19
16 0.2
17 0.21
18 0.2
19 0.24
20 0.25
21 0.25
22 0.27
23 0.26
24 0.25
25 0.25
26 0.24
27 0.2
28 0.18
29 0.19
30 0.17
31 0.16
32 0.19
33 0.22
34 0.28
35 0.34
36 0.4
37 0.47
38 0.56
39 0.66
40 0.74
41 0.79
42 0.85
43 0.88
44 0.92
45 0.91
46 0.89
47 0.85
48 0.77
49 0.68
50 0.6
51 0.54
52 0.48
53 0.42
54 0.36
55 0.31
56 0.29
57 0.28
58 0.28
59 0.24
60 0.2
61 0.21
62 0.21
63 0.21
64 0.21
65 0.21
66 0.19
67 0.2
68 0.24
69 0.24
70 0.24
71 0.23
72 0.25
73 0.26
74 0.27
75 0.3
76 0.33
77 0.32
78 0.34
79 0.36
80 0.34
81 0.36
82 0.33
83 0.3
84 0.22
85 0.27
86 0.26
87 0.24
88 0.25
89 0.22
90 0.23
91 0.23
92 0.25
93 0.18
94 0.16
95 0.15
96 0.13
97 0.14
98 0.18
99 0.18
100 0.18
101 0.21
102 0.26
103 0.29
104 0.29
105 0.32
106 0.36
107 0.38
108 0.42
109 0.4
110 0.43
111 0.41
112 0.45
113 0.44
114 0.36
115 0.34
116 0.32
117 0.35
118 0.29
119 0.32
120 0.29
121 0.28
122 0.27
123 0.29
124 0.26
125 0.2
126 0.24
127 0.2
128 0.24
129 0.26
130 0.27
131 0.26
132 0.31
133 0.31
134 0.26
135 0.27
136 0.23
137 0.2
138 0.19
139 0.16
140 0.12
141 0.14
142 0.12
143 0.11
144 0.17
145 0.18
146 0.17
147 0.18
148 0.2
149 0.2
150 0.22
151 0.23
152 0.18
153 0.18
154 0.19
155 0.19
156 0.16
157 0.14
158 0.14
159 0.14
160 0.14
161 0.13
162 0.16
163 0.15
164 0.17
165 0.22
166 0.2
167 0.2
168 0.2
169 0.25
170 0.23
171 0.23
172 0.24
173 0.2
174 0.23
175 0.22
176 0.21
177 0.17
178 0.16
179 0.15
180 0.13
181 0.13
182 0.1
183 0.1
184 0.09
185 0.08
186 0.08
187 0.08
188 0.1
189 0.1
190 0.11
191 0.14
192 0.2
193 0.24
194 0.27
195 0.36
196 0.41
197 0.48
198 0.52
199 0.55
200 0.53
201 0.55
202 0.58
203 0.55
204 0.5
205 0.44
206 0.43
207 0.4
208 0.37
209 0.32
210 0.25
211 0.21
212 0.18
213 0.16
214 0.11
215 0.09
216 0.08
217 0.08
218 0.08
219 0.09
220 0.09
221 0.08
222 0.08
223 0.09
224 0.1
225 0.12
226 0.16
227 0.14
228 0.14
229 0.14
230 0.14
231 0.13
232 0.11
233 0.09
234 0.05
235 0.05
236 0.05
237 0.05
238 0.06
239 0.07
240 0.11
241 0.15
242 0.15
243 0.16
244 0.18
245 0.21
246 0.21
247 0.21
248 0.21
249 0.22
250 0.23
251 0.23
252 0.26
253 0.26
254 0.27
255 0.26
256 0.24
257 0.24
258 0.26
259 0.28
260 0.27
261 0.25
262 0.24
263 0.23
264 0.22
265 0.18
266 0.18
267 0.18
268 0.16
269 0.17
270 0.18
271 0.21
272 0.25
273 0.25
274 0.25
275 0.28