Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0X190

Protein Details
Accession A0A4T0X190    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
55-85QRSFYRLPQQDRRSRRQRQKERKKSDSSDLQHydrophilic
NLS Segment(s)
PositionSequence
66-78RRSRRQRQKERKK
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 1, extr 1, pero 1, golg 1, cysk 1
Family & Domain DBs
Amino Acid Sequences MTDNDTSALLLSLLKPSPSPSPQTQCVKYETDLLWKLQNSPLIQPKSYWSKLLPQRSFYRLPQQDRRSRRQRQKERKKSDSSDLQLDLHSNSNSKNQTLDFELWKLSMKIDSARENGVDLSNAVDLSNAVEELKQLQNPTVPAPIVPTVPFHNSVDDEFDLSNNLTTSTNPVNSTSRFMPLLNHSIQSQPMPQLNHQPLPSQPPVQPIVQPLPSQIPYVQPMHLSPSSVSPPSLSSPSLPSNHPLLQLLQRKNLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.16
4 0.23
5 0.26
6 0.31
7 0.36
8 0.42
9 0.5
10 0.58
11 0.6
12 0.56
13 0.56
14 0.53
15 0.46
16 0.45
17 0.38
18 0.38
19 0.36
20 0.35
21 0.36
22 0.33
23 0.34
24 0.31
25 0.34
26 0.28
27 0.32
28 0.39
29 0.38
30 0.38
31 0.36
32 0.39
33 0.43
34 0.43
35 0.39
36 0.32
37 0.37
38 0.45
39 0.55
40 0.53
41 0.49
42 0.53
43 0.56
44 0.59
45 0.53
46 0.56
47 0.53
48 0.57
49 0.62
50 0.66
51 0.69
52 0.73
53 0.79
54 0.79
55 0.82
56 0.84
57 0.86
58 0.87
59 0.9
60 0.93
61 0.94
62 0.94
63 0.93
64 0.91
65 0.85
66 0.82
67 0.8
68 0.72
69 0.66
70 0.57
71 0.49
72 0.4
73 0.35
74 0.28
75 0.21
76 0.18
77 0.13
78 0.13
79 0.18
80 0.19
81 0.19
82 0.19
83 0.17
84 0.18
85 0.21
86 0.22
87 0.17
88 0.17
89 0.17
90 0.16
91 0.16
92 0.14
93 0.11
94 0.1
95 0.09
96 0.11
97 0.14
98 0.16
99 0.17
100 0.17
101 0.17
102 0.17
103 0.16
104 0.13
105 0.1
106 0.07
107 0.07
108 0.06
109 0.06
110 0.05
111 0.05
112 0.04
113 0.05
114 0.05
115 0.04
116 0.03
117 0.03
118 0.04
119 0.07
120 0.08
121 0.08
122 0.09
123 0.09
124 0.11
125 0.11
126 0.13
127 0.11
128 0.1
129 0.09
130 0.11
131 0.11
132 0.11
133 0.1
134 0.11
135 0.11
136 0.13
137 0.16
138 0.14
139 0.15
140 0.15
141 0.15
142 0.17
143 0.15
144 0.14
145 0.12
146 0.11
147 0.11
148 0.1
149 0.1
150 0.07
151 0.08
152 0.07
153 0.07
154 0.11
155 0.13
156 0.15
157 0.15
158 0.17
159 0.19
160 0.2
161 0.24
162 0.21
163 0.21
164 0.2
165 0.2
166 0.2
167 0.21
168 0.26
169 0.23
170 0.23
171 0.21
172 0.22
173 0.23
174 0.21
175 0.19
176 0.17
177 0.2
178 0.21
179 0.22
180 0.31
181 0.34
182 0.37
183 0.36
184 0.35
185 0.33
186 0.38
187 0.39
188 0.33
189 0.3
190 0.31
191 0.33
192 0.32
193 0.32
194 0.29
195 0.31
196 0.3
197 0.29
198 0.26
199 0.29
200 0.29
201 0.29
202 0.25
203 0.23
204 0.24
205 0.26
206 0.25
207 0.21
208 0.2
209 0.25
210 0.25
211 0.23
212 0.2
213 0.23
214 0.26
215 0.26
216 0.25
217 0.2
218 0.21
219 0.23
220 0.25
221 0.22
222 0.19
223 0.23
224 0.29
225 0.31
226 0.3
227 0.3
228 0.33
229 0.34
230 0.34
231 0.31
232 0.29
233 0.35
234 0.43
235 0.44