Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q751J0

Protein Details
Accession Q751J0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-132RFYLKPGKVKEQQRSRKHRREFMRAFKGLBasic
NLS Segment(s)
PositionSequence
108-128KPGKVKEQQRSRKHRREFMRA
Subcellular Location(s) mito 18.5, cyto_mito 11, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0070124  P:mitochondrial translational initiation  
KEGG ago:AGOS_AGL284C  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MLRLLAPRPLTARPFSSALRALQQPAFDPTLLDAASAVGARAGDPALHAASMLSPREDAFRSRLTGVRAGRTVSVFNGNTSQALQRQNMLLRSARIAQDRREQRFYLKPGKVKEQQRSRKHRREFMRAFKGLIEVVKDAKRKGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.35
4 0.34
5 0.31
6 0.32
7 0.31
8 0.3
9 0.28
10 0.28
11 0.24
12 0.25
13 0.25
14 0.19
15 0.18
16 0.15
17 0.16
18 0.15
19 0.13
20 0.09
21 0.07
22 0.08
23 0.07
24 0.06
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.04
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.06
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.1
44 0.11
45 0.12
46 0.13
47 0.15
48 0.16
49 0.18
50 0.2
51 0.2
52 0.24
53 0.24
54 0.23
55 0.22
56 0.21
57 0.2
58 0.18
59 0.17
60 0.12
61 0.16
62 0.13
63 0.13
64 0.13
65 0.13
66 0.12
67 0.13
68 0.13
69 0.12
70 0.15
71 0.15
72 0.14
73 0.16
74 0.19
75 0.19
76 0.2
77 0.18
78 0.16
79 0.18
80 0.19
81 0.2
82 0.24
83 0.25
84 0.27
85 0.35
86 0.43
87 0.47
88 0.49
89 0.47
90 0.47
91 0.52
92 0.54
93 0.55
94 0.53
95 0.52
96 0.52
97 0.6
98 0.63
99 0.64
100 0.67
101 0.68
102 0.73
103 0.78
104 0.84
105 0.86
106 0.88
107 0.89
108 0.88
109 0.86
110 0.87
111 0.86
112 0.86
113 0.85
114 0.77
115 0.69
116 0.6
117 0.54
118 0.44
119 0.36
120 0.28
121 0.19
122 0.22
123 0.27
124 0.3