Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0WWM9

Protein Details
Accession A0A4T0WWM9    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAHSLRSKSKKVSKKIKCSNPNSDYFKHydrophilic
82-111LKVKTHGWRKSRSQDYKKKKISKRNKSIKFBasic
NLS Segment(s)
PositionSequence
89-111WRKSRSQDYKKKKISKRNKSIKF
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAHSLRSKSKKVSKKIKCSNPNSDYFKTAKERAQRLAEKLKGNLEQQKTATVVDADDESKMQTDDNENADSASASVNAEELLKVKTHGWRKSRSQDYKKKKISKRNKSIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.9
4 0.9
5 0.89
6 0.89
7 0.84
8 0.82
9 0.79
10 0.71
11 0.64
12 0.55
13 0.52
14 0.47
15 0.45
16 0.42
17 0.42
18 0.44
19 0.46
20 0.53
21 0.51
22 0.51
23 0.56
24 0.56
25 0.5
26 0.48
27 0.46
28 0.4
29 0.4
30 0.41
31 0.35
32 0.32
33 0.3
34 0.3
35 0.26
36 0.23
37 0.2
38 0.13
39 0.1
40 0.08
41 0.08
42 0.06
43 0.06
44 0.06
45 0.05
46 0.06
47 0.06
48 0.05
49 0.05
50 0.08
51 0.1
52 0.12
53 0.13
54 0.13
55 0.13
56 0.13
57 0.12
58 0.09
59 0.07
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.08
71 0.1
72 0.18
73 0.26
74 0.34
75 0.4
76 0.47
77 0.55
78 0.65
79 0.73
80 0.77
81 0.8
82 0.83
83 0.87
84 0.9
85 0.92
86 0.92
87 0.9
88 0.9
89 0.91
90 0.91
91 0.92