Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0WW06

Protein Details
Accession A0A4T0WW06    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
104-128SQIMHAKRVDRLRRREKRNKLLKERBasic
NLS Segment(s)
PositionSequence
24-128GKGKRVSGKNWKVEKKAFRIKSLGVRTAWEKRQEQRLREKEEKQRLKDLQAEKEAAHKAKILRIKEKREKKAEEERYERLSQIMHAKRVDRLRRREKRNKLLKER
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSDDKNMIEVPKETLAEVLPVDPGKGKRVSGKNWKVEKKAFRIKSLGVRTAWEKRQEQRLREKEEKQRLKDLQAEKEAAHKAKILRIKEKREKKAEEERYERLSQIMHAKRVDRLRRREKRNKLLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.16
4 0.16
5 0.12
6 0.1
7 0.1
8 0.1
9 0.14
10 0.15
11 0.18
12 0.2
13 0.21
14 0.28
15 0.34
16 0.42
17 0.49
18 0.57
19 0.62
20 0.7
21 0.75
22 0.72
23 0.74
24 0.73
25 0.71
26 0.72
27 0.66
28 0.6
29 0.57
30 0.54
31 0.55
32 0.52
33 0.47
34 0.37
35 0.36
36 0.36
37 0.39
38 0.4
39 0.37
40 0.36
41 0.36
42 0.46
43 0.5
44 0.51
45 0.55
46 0.58
47 0.61
48 0.64
49 0.67
50 0.66
51 0.71
52 0.73
53 0.65
54 0.66
55 0.59
56 0.56
57 0.56
58 0.51
59 0.46
60 0.41
61 0.39
62 0.31
63 0.35
64 0.35
65 0.28
66 0.24
67 0.22
68 0.19
69 0.23
70 0.29
71 0.28
72 0.35
73 0.42
74 0.52
75 0.59
76 0.68
77 0.73
78 0.76
79 0.77
80 0.75
81 0.78
82 0.78
83 0.76
84 0.72
85 0.68
86 0.65
87 0.61
88 0.54
89 0.44
90 0.34
91 0.28
92 0.32
93 0.33
94 0.32
95 0.34
96 0.35
97 0.41
98 0.5
99 0.57
100 0.57
101 0.62
102 0.68
103 0.76
104 0.85
105 0.89
106 0.9
107 0.91
108 0.92