Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q750Q4

Protein Details
Accession Q750Q4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
613-638SKSSYGFRDTNKRHRRGRLDDSGRLEHydrophilic
NLS Segment(s)
PositionSequence
61-93RSSRWEGRGSDREDGERGSRGGMWRKPQGRRGR
Subcellular Location(s) mito 15, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0005739  C:mitochondrion  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003724  F:RNA helicase activity  
GO:0033592  F:RNA strand annealing activity  
GO:0000372  P:Group I intron splicing  
GO:0000373  P:Group II intron splicing  
GO:0000963  P:mitochondrial RNA processing  
GO:0006397  P:mRNA processing  
GO:0006417  P:regulation of translation  
GO:0034337  P:RNA folding  
GO:0006392  P:transcription elongation by mitochondrial RNA polymerase  
KEGG ago:AGOS_AGL112C  -  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
PS51195  Q_MOTIF  
CDD cd17964  DEADc_MSS116  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MFRVTGIATARAVALQPFRAPLGVIRRFGISATASYEFQHGHDMQSRNGSRWDSRRQGDRRSSRWEGRGSDREDGERGSRGGMWRKPQGRRGRTDGAAREGFSLGPNTEVVRVADEAAGVESTPRTLVEEGVLSNELYEMLQSRGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEGPPSENVKAVVIAPTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRRPNIVVATPGRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKGTTHIRTLLVSATLDDKVQSLANSIMNHAKCLFIDTVDPNEQATNENIAQKVVISKDFADNITASLYKIREEASANPKLKAIVFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILVCTDVAARGMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKGSSTIFLAEHELCILDILRRKNNVVISDQETFDAAAQELSDVREAFSLDRDRLHDFLLKNLSFYRGSQGEYDFPLEAYISIARAYGTLLGDSNQRLTLSGRMLTTFVPNHPAVCSLFNIIGPVNSKSSYGFRDTNKRHRRGRLDDSGRLEYSKKRHSYARSYSPSISDGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.18
4 0.19
5 0.19
6 0.19
7 0.19
8 0.21
9 0.28
10 0.32
11 0.32
12 0.32
13 0.33
14 0.33
15 0.32
16 0.3
17 0.22
18 0.17
19 0.2
20 0.21
21 0.19
22 0.2
23 0.22
24 0.19
25 0.18
26 0.24
27 0.2
28 0.22
29 0.29
30 0.31
31 0.31
32 0.41
33 0.42
34 0.37
35 0.42
36 0.42
37 0.41
38 0.47
39 0.55
40 0.53
41 0.58
42 0.66
43 0.68
44 0.74
45 0.77
46 0.78
47 0.75
48 0.75
49 0.78
50 0.75
51 0.76
52 0.72
53 0.67
54 0.67
55 0.69
56 0.64
57 0.62
58 0.56
59 0.52
60 0.47
61 0.43
62 0.37
63 0.31
64 0.27
65 0.22
66 0.23
67 0.26
68 0.33
69 0.36
70 0.4
71 0.46
72 0.54
73 0.6
74 0.67
75 0.72
76 0.72
77 0.74
78 0.75
79 0.73
80 0.7
81 0.7
82 0.66
83 0.63
84 0.56
85 0.49
86 0.43
87 0.36
88 0.31
89 0.24
90 0.22
91 0.14
92 0.13
93 0.13
94 0.12
95 0.13
96 0.14
97 0.13
98 0.13
99 0.13
100 0.13
101 0.12
102 0.11
103 0.1
104 0.09
105 0.09
106 0.07
107 0.07
108 0.06
109 0.06
110 0.07
111 0.06
112 0.08
113 0.09
114 0.09
115 0.1
116 0.11
117 0.11
118 0.13
119 0.13
120 0.11
121 0.1
122 0.1
123 0.08
124 0.07
125 0.07
126 0.07
127 0.07
128 0.09
129 0.09
130 0.1
131 0.13
132 0.13
133 0.14
134 0.16
135 0.22
136 0.29
137 0.37
138 0.38
139 0.42
140 0.47
141 0.5
142 0.53
143 0.55
144 0.48
145 0.41
146 0.44
147 0.41
148 0.4
149 0.4
150 0.35
151 0.31
152 0.29
153 0.29
154 0.25
155 0.22
156 0.2
157 0.16
158 0.15
159 0.14
160 0.15
161 0.16
162 0.18
163 0.17
164 0.16
165 0.19
166 0.18
167 0.15
168 0.14
169 0.13
170 0.12
171 0.14
172 0.13
173 0.1
174 0.11
175 0.11
176 0.13
177 0.14
178 0.14
179 0.13
180 0.16
181 0.2
182 0.2
183 0.19
184 0.17
185 0.15
186 0.14
187 0.14
188 0.15
189 0.13
190 0.13
191 0.13
192 0.13
193 0.13
194 0.12
195 0.12
196 0.08
197 0.09
198 0.09
199 0.1
200 0.1
201 0.09
202 0.11
203 0.1
204 0.11
205 0.1
206 0.11
207 0.1
208 0.19
209 0.22
210 0.28
211 0.35
212 0.39
213 0.46
214 0.49
215 0.55
216 0.48
217 0.48
218 0.47
219 0.41
220 0.37
221 0.29
222 0.25
223 0.19
224 0.17
225 0.14
226 0.07
227 0.07
228 0.08
229 0.08
230 0.09
231 0.1
232 0.17
233 0.26
234 0.31
235 0.39
236 0.46
237 0.51
238 0.54
239 0.54
240 0.5
241 0.46
242 0.41
243 0.4
244 0.33
245 0.3
246 0.27
247 0.25
248 0.22
249 0.17
250 0.16
251 0.1
252 0.09
253 0.07
254 0.09
255 0.09
256 0.09
257 0.09
258 0.1
259 0.08
260 0.09
261 0.09
262 0.08
263 0.15
264 0.15
265 0.17
266 0.17
267 0.18
268 0.17
269 0.16
270 0.15
271 0.09
272 0.09
273 0.05
274 0.05
275 0.05
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.07
284 0.09
285 0.1
286 0.11
287 0.11
288 0.12
289 0.12
290 0.13
291 0.1
292 0.09
293 0.08
294 0.08
295 0.08
296 0.07
297 0.07
298 0.1
299 0.12
300 0.14
301 0.15
302 0.16
303 0.16
304 0.16
305 0.17
306 0.14
307 0.12
308 0.1
309 0.09
310 0.08
311 0.08
312 0.07
313 0.07
314 0.06
315 0.07
316 0.07
317 0.07
318 0.06
319 0.07
320 0.1
321 0.1
322 0.11
323 0.15
324 0.15
325 0.16
326 0.15
327 0.14
328 0.11
329 0.14
330 0.13
331 0.08
332 0.1
333 0.1
334 0.14
335 0.15
336 0.15
337 0.13
338 0.13
339 0.13
340 0.12
341 0.12
342 0.11
343 0.11
344 0.12
345 0.12
346 0.12
347 0.11
348 0.1
349 0.12
350 0.1
351 0.09
352 0.08
353 0.09
354 0.11
355 0.12
356 0.12
357 0.11
358 0.1
359 0.1
360 0.1
361 0.09
362 0.08
363 0.1
364 0.1
365 0.09
366 0.1
367 0.1
368 0.11
369 0.12
370 0.19
371 0.23
372 0.31
373 0.32
374 0.32
375 0.31
376 0.3
377 0.28
378 0.24
379 0.18
380 0.14
381 0.14
382 0.13
383 0.13
384 0.12
385 0.12
386 0.1
387 0.09
388 0.05
389 0.05
390 0.04
391 0.04
392 0.04
393 0.04
394 0.04
395 0.05
396 0.07
397 0.08
398 0.09
399 0.09
400 0.1
401 0.11
402 0.11
403 0.13
404 0.12
405 0.14
406 0.15
407 0.15
408 0.14
409 0.14
410 0.15
411 0.13
412 0.14
413 0.14
414 0.15
415 0.16
416 0.2
417 0.21
418 0.27
419 0.36
420 0.44
421 0.44
422 0.47
423 0.49
424 0.47
425 0.5
426 0.45
427 0.37
428 0.3
429 0.28
430 0.22
431 0.19
432 0.18
433 0.11
434 0.1
435 0.08
436 0.05
437 0.04
438 0.04
439 0.04
440 0.04
441 0.05
442 0.05
443 0.05
444 0.05
445 0.07
446 0.08
447 0.08
448 0.09
449 0.09
450 0.1
451 0.12
452 0.12
453 0.1
454 0.1
455 0.1
456 0.1
457 0.11
458 0.11
459 0.11
460 0.13
461 0.16
462 0.2
463 0.22
464 0.22
465 0.25
466 0.27
467 0.31
468 0.35
469 0.39
470 0.41
471 0.47
472 0.48
473 0.46
474 0.48
475 0.45
476 0.39
477 0.35
478 0.3
479 0.24
480 0.22
481 0.21
482 0.2
483 0.17
484 0.16
485 0.13
486 0.12
487 0.1
488 0.09
489 0.09
490 0.09
491 0.14
492 0.19
493 0.24
494 0.25
495 0.27
496 0.31
497 0.34
498 0.34
499 0.32
500 0.32
501 0.32
502 0.33
503 0.32
504 0.28
505 0.24
506 0.21
507 0.19
508 0.15
509 0.1
510 0.07
511 0.07
512 0.07
513 0.07
514 0.08
515 0.09
516 0.09
517 0.09
518 0.1
519 0.1
520 0.11
521 0.16
522 0.19
523 0.18
524 0.21
525 0.23
526 0.25
527 0.26
528 0.27
529 0.27
530 0.24
531 0.29
532 0.35
533 0.32
534 0.3
535 0.3
536 0.31
537 0.27
538 0.27
539 0.28
540 0.21
541 0.23
542 0.24
543 0.25
544 0.24
545 0.25
546 0.27
547 0.2
548 0.18
549 0.17
550 0.15
551 0.12
552 0.11
553 0.1
554 0.08
555 0.08
556 0.08
557 0.08
558 0.08
559 0.08
560 0.09
561 0.09
562 0.09
563 0.1
564 0.11
565 0.14
566 0.15
567 0.16
568 0.15
569 0.14
570 0.15
571 0.16
572 0.2
573 0.2
574 0.21
575 0.2
576 0.2
577 0.21
578 0.21
579 0.25
580 0.23
581 0.21
582 0.24
583 0.24
584 0.24
585 0.23
586 0.25
587 0.21
588 0.21
589 0.21
590 0.18
591 0.18
592 0.17
593 0.18
594 0.16
595 0.16
596 0.17
597 0.18
598 0.18
599 0.18
600 0.18
601 0.19
602 0.24
603 0.25
604 0.29
605 0.32
606 0.36
607 0.47
608 0.55
609 0.64
610 0.7
611 0.75
612 0.78
613 0.82
614 0.86
615 0.84
616 0.85
617 0.85
618 0.83
619 0.82
620 0.8
621 0.76
622 0.67
623 0.59
624 0.52
625 0.49
626 0.49
627 0.51
628 0.49
629 0.48
630 0.55
631 0.61
632 0.69
633 0.72
634 0.74
635 0.72
636 0.72
637 0.7
638 0.65