FuNGI

Q750Q4

Protein Details

Accession

Q750Q4

Localization Confidence

Low

Confidence Score

9.5

NoLS Segment(s)

Position	Sequence	Protein Nature
613-638	SKSSYGFRDTNKRHRRGRLDDSGRLE	Hydrophilic

NLS Segment(s)

Position	Sequence
61-93	RSSRWEGRGSDREDGERGSRGGMWRKPQGRRGR

Subcellular Location(s)

mito 15, cyto 5.5, cyto_nucl 5.5, nucl 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR011545 DEAD/DEAH_box_helicase_dom IPR014001 Helicase_ATP-bd IPR001650 Helicase_C IPR027417 P-loop_NTPase
Gene Ontology	GO:0005759 C:mitochondrial matrix GO:0005739 C:mitochondrion GO:0005524 F:ATP binding GO:0016887 F:ATP hydrolysis activity GO:0003724 F:RNA helicase activity GO:0033592 F:RNA strand annealing activity GO:0000372 P:Group I intron splicing GO:0000373 P:Group II intron splicing GO:0000963 P:mitochondrial RNA processing GO:0006397 P:mRNA processing GO:0006417 P:regulation of translation GO:0034337 P:RNA folding GO:0006392 P:transcription elongation by mitochondrial RNA polymerase
KEGG	ago:AGOS_AGL112C -
Pfam	View protein in Pfam PF00270 DEAD PF00271 Helicase_C
PROSITE	View protein in PROSITE PS51192 HELICASE_ATP_BIND_1 PS51194 HELICASE_CTER PS51195 Q_MOTIF
CDD	cd17964 DEADc_MSS116 cd18787 SF2_C_DEAD

Amino Acid Sequences

MFRVTGIATARAVALQPFRAPLGVIRRFGISATASYEFQHGHDMQSRNGSRWDSRRQGDRRSSRWEGRGSDREDGERGSRGGMWRKPQGRRGRTDGAAREGFSLGPNTEVVRVADEAAGVESTPRTLVEEGVLSNELYEMLQSRGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEGPPSENVKAVVIAPTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRRPNIVVATPGRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKGTTHIRTLLVSATLDDKVQSLANSIMNHAKCLFIDTVDPNEQATNENIAQKVVISKDFADNITASLYKIREEASANPKLKAIVFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILVCTDVAARGMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKGSSTIFLAEHELCILDILRRKNNVVISDQETFDAAAQELSDVREAFSLDRDRLHDFLLKNLSFYRGSQGEYDFPLEAYISIARAYGTLLGDSNQRLTLSGRMLTTFVPNHPAVCSLFNIIGPVNSKSSYGFRDTNKRHRRGRLDDSGRLEYSKKRHSYARSYSPSISDGF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.16
2	0.16
3	0.18
4	0.19
5	0.19
6	0.19
7	0.19
8	0.21
9	0.28
10	0.32
11	0.32
12	0.32
13	0.33
14	0.33
15	0.32
16	0.3
17	0.22
18	0.17
19	0.2
20	0.21
21	0.19
22	0.2
23	0.22
24	0.19
25	0.18
26	0.24
27	0.2
28	0.22
29	0.29
30	0.31
31	0.31
32	0.41
33	0.42
34	0.37
35	0.42
36	0.42
37	0.41
38	0.47
39	0.55
40	0.53
41	0.58
42	0.66
43	0.68
44	0.74
45	0.77
46	0.78
47	0.75
48	0.75
49	0.78
50	0.75
51	0.76
52	0.72
53	0.67
54	0.67
55	0.69
56	0.64
57	0.62
58	0.56
59	0.52
60	0.47
61	0.43
62	0.37
63	0.31
64	0.27
65	0.22
66	0.23
67	0.26
68	0.33
69	0.36
70	0.4
71	0.46
72	0.54
73	0.6
74	0.67
75	0.72
76	0.72
77	0.74
78	0.75
79	0.73
80	0.7
81	0.7
82	0.66
83	0.63
84	0.56
85	0.49
86	0.43
87	0.36
88	0.31
89	0.24
90	0.22
91	0.14
92	0.13
93	0.13
94	0.12
95	0.13
96	0.14
97	0.13
98	0.13
99	0.13
100	0.13
101	0.12
102	0.11
103	0.1
104	0.09
105	0.09
106	0.07
107	0.07
108	0.06
109	0.06
110	0.07
111	0.06
112	0.08
113	0.09
114	0.09
115	0.1
116	0.11
117	0.11
118	0.13
119	0.13
120	0.11
121	0.1
122	0.1
123	0.08
124	0.07
125	0.07
126	0.07
127	0.07
128	0.09
129	0.09
130	0.1
131	0.13
132	0.13
133	0.14
134	0.16
135	0.22
136	0.29
137	0.37
138	0.38
139	0.42
140	0.47
141	0.5
142	0.53
143	0.55
144	0.48
145	0.41
146	0.44
147	0.41
148	0.4
149	0.4
150	0.35
151	0.31
152	0.29
153	0.29
154	0.25
155	0.22
156	0.2
157	0.16
158	0.15
159	0.14
160	0.15
161	0.16
162	0.18
163	0.17
164	0.16
165	0.19
166	0.18
167	0.15
168	0.14
169	0.13
170	0.12
171	0.14
172	0.13
173	0.1
174	0.11
175	0.11
176	0.13
177	0.14
178	0.14
179	0.13
180	0.16
181	0.2
182	0.2
183	0.19
184	0.17
185	0.15
186	0.14
187	0.14
188	0.15
189	0.13
190	0.13
191	0.13
192	0.13
193	0.13
194	0.12
195	0.12
196	0.08
197	0.09
198	0.09
199	0.1
200	0.1
201	0.09
202	0.11
203	0.1
204	0.11
205	0.1
206	0.11
207	0.1
208	0.19
209	0.22
210	0.28
211	0.35
212	0.39
213	0.46
214	0.49
215	0.55
216	0.48
217	0.48
218	0.47
219	0.41
220	0.37
221	0.29
222	0.25
223	0.19
224	0.17
225	0.14
226	0.07
227	0.07
228	0.08
229	0.08
230	0.09
231	0.1
232	0.17
233	0.26
234	0.31
235	0.39
236	0.46
237	0.51
238	0.54
239	0.54
240	0.5
241	0.46
242	0.41
243	0.4
244	0.33
245	0.3
246	0.27
247	0.25
248	0.22
249	0.17
250	0.16
251	0.1
252	0.09
253	0.07
254	0.09
255	0.09
256	0.09
257	0.09
258	0.1
259	0.08
260	0.09
261	0.09
262	0.08
263	0.15
264	0.15
265	0.17
266	0.17
267	0.18
268	0.17
269	0.16
270	0.15
271	0.09
272	0.09
273	0.05
274	0.05
275	0.05
276	0.04
277	0.04
278	0.04
279	0.04
280	0.04
281	0.04
282	0.04
283	0.07
284	0.09
285	0.1
286	0.11
287	0.11
288	0.12
289	0.12
290	0.13
291	0.1
292	0.09
293	0.08
294	0.08
295	0.08
296	0.07
297	0.07
298	0.1
299	0.12
300	0.14
301	0.15
302	0.16
303	0.16
304	0.16
305	0.17
306	0.14
307	0.12
308	0.1
309	0.09
310	0.08
311	0.08
312	0.07
313	0.07
314	0.06
315	0.07
316	0.07
317	0.07
318	0.06
319	0.07
320	0.1
321	0.1
322	0.11
323	0.15
324	0.15
325	0.16
326	0.15
327	0.14
328	0.11
329	0.14
330	0.13
331	0.08
332	0.1
333	0.1
334	0.14
335	0.15
336	0.15
337	0.13
338	0.13
339	0.13
340	0.12
341	0.12
342	0.11
343	0.11
344	0.12
345	0.12
346	0.12
347	0.11
348	0.1
349	0.12
350	0.1
351	0.09
352	0.08
353	0.09
354	0.11
355	0.12
356	0.12
357	0.11
358	0.1
359	0.1
360	0.1
361	0.09
362	0.08
363	0.1
364	0.1
365	0.09
366	0.1
367	0.1
368	0.11
369	0.12
370	0.19
371	0.23
372	0.31
373	0.32
374	0.32
375	0.31
376	0.3
377	0.28
378	0.24
379	0.18
380	0.14
381	0.14
382	0.13
383	0.13
384	0.12
385	0.12
386	0.1
387	0.09
388	0.05
389	0.05
390	0.04
391	0.04
392	0.04
393	0.04
394	0.04
395	0.05
396	0.07
397	0.08
398	0.09
399	0.09
400	0.1
401	0.11
402	0.11
403	0.13
404	0.12
405	0.14
406	0.15
407	0.15
408	0.14
409	0.14
410	0.15
411	0.13
412	0.14
413	0.14
414	0.15
415	0.16
416	0.2
417	0.21
418	0.27
419	0.36
420	0.44
421	0.44
422	0.47
423	0.49
424	0.47
425	0.5
426	0.45
427	0.37
428	0.3
429	0.28
430	0.22
431	0.19
432	0.18
433	0.11
434	0.1
435	0.08
436	0.05
437	0.04
438	0.04
439	0.04
440	0.04
441	0.05
442	0.05
443	0.05
444	0.05
445	0.07
446	0.08
447	0.08
448	0.09
449	0.09
450	0.1
451	0.12
452	0.12
453	0.1
454	0.1
455	0.1
456	0.1
457	0.11
458	0.11
459	0.11
460	0.13
461	0.16
462	0.2
463	0.22
464	0.22
465	0.25
466	0.27
467	0.31
468	0.35
469	0.39
470	0.41
471	0.47
472	0.48
473	0.46
474	0.48
475	0.45
476	0.39
477	0.35
478	0.3
479	0.24
480	0.22
481	0.21
482	0.2
483	0.17
484	0.16
485	0.13
486	0.12
487	0.1
488	0.09
489	0.09
490	0.09
491	0.14
492	0.19
493	0.24
494	0.25
495	0.27
496	0.31
497	0.34
498	0.34
499	0.32
500	0.32
501	0.32
502	0.33
503	0.32
504	0.28
505	0.24
506	0.21
507	0.19
508	0.15
509	0.1
510	0.07
511	0.07
512	0.07
513	0.07
514	0.08
515	0.09
516	0.09
517	0.09
518	0.1
519	0.1
520	0.11
521	0.16
522	0.19
523	0.18
524	0.21
525	0.23
526	0.25
527	0.26
528	0.27
529	0.27
530	0.24
531	0.29
532	0.35
533	0.32
534	0.3
535	0.3
536	0.31
537	0.27
538	0.27
539	0.28
540	0.21
541	0.23
542	0.24
543	0.25
544	0.24
545	0.25
546	0.27
547	0.2
548	0.18
549	0.17
550	0.15
551	0.12
552	0.11
553	0.1
554	0.08
555	0.08
556	0.08
557	0.08
558	0.08
559	0.08
560	0.09
561	0.09
562	0.09
563	0.1
564	0.11
565	0.14
566	0.15
567	0.16
568	0.15
569	0.14
570	0.15
571	0.16
572	0.2
573	0.2
574	0.21
575	0.2
576	0.2
577	0.21
578	0.21
579	0.25
580	0.23
581	0.21
582	0.24
583	0.24
584	0.24
585	0.23
586	0.25
587	0.21
588	0.21
589	0.21
590	0.18
591	0.18
592	0.17
593	0.18
594	0.16
595	0.16
596	0.17
597	0.18
598	0.18
599	0.18
600	0.18
601	0.19
602	0.24
603	0.25
604	0.29
605	0.32
606	0.36
607	0.47
608	0.55
609	0.64
610	0.7
611	0.75
612	0.78
613	0.82
614	0.86
615	0.84
616	0.85
617	0.85
618	0.83
619	0.82
620	0.8
621	0.76
622	0.67
623	0.59
624	0.52
625	0.49
626	0.49
627	0.51
628	0.49
629	0.48
630	0.55
631	0.61
632	0.69
633	0.72
634	0.74
635	0.72
636	0.72
637	0.7
638	0.65

Q750Q4

3D AlphaFold-predicted Structure Viewer