Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0WY50

Protein Details
Accession A0A4T0WY50    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-40LLWKKPWRLSAPQKRRQRARMQMVDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRSTFVTMSGLLWKKPWRLSAPQKRRQRARMQMVDSNIDALYEGLVSNDMKSKKVFELFENFPREKDMLPRDKYTVFNKHARGYRKGVHFVPKWTKLSLRNNPENF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.24
4 0.28
5 0.31
6 0.34
7 0.39
8 0.36
9 0.44
10 0.55
11 0.63
12 0.69
13 0.73
14 0.8
15 0.83
16 0.86
17 0.85
18 0.84
19 0.83
20 0.82
21 0.81
22 0.76
23 0.71
24 0.65
25 0.58
26 0.48
27 0.39
28 0.28
29 0.19
30 0.13
31 0.09
32 0.07
33 0.04
34 0.04
35 0.03
36 0.04
37 0.04
38 0.05
39 0.09
40 0.1
41 0.11
42 0.11
43 0.13
44 0.14
45 0.18
46 0.19
47 0.17
48 0.23
49 0.26
50 0.32
51 0.36
52 0.35
53 0.31
54 0.32
55 0.3
56 0.24
57 0.27
58 0.29
59 0.33
60 0.36
61 0.39
62 0.4
63 0.41
64 0.45
65 0.45
66 0.45
67 0.42
68 0.45
69 0.46
70 0.5
71 0.54
72 0.56
73 0.55
74 0.52
75 0.54
76 0.54
77 0.56
78 0.53
79 0.57
80 0.54
81 0.58
82 0.61
83 0.61
84 0.57
85 0.54
86 0.56
87 0.56
88 0.63
89 0.64
90 0.65