Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0X2K2

Protein Details
Accession A0A4T0X2K2    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-38SVVPTLRRSRRYFERREKKGKKNEKNENDDGTNHydrophilic
NLS Segment(s)
PositionSequence
12-28RRSRRYFERREKKGKKN
Subcellular Location(s) nucl 19, mito_nucl 13.499, cyto_nucl 11.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MNGNKSVVPTLRRSRRYFERREKKGKKNEKNENDDGTNIKGEQGSPLSWIFQKLSRSGENLSESPIIASAESKSSSVFVMLSSGDVIEENVALVLLEEMLEEVISEAENKSRNGDLRAACLVVHCKALKKWKEFDRIEDWRVIIQSVQLLVNIISEKREDSVVEQVKLPEQIEYSYKDCVDELNNELIRGMHGLNIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.76
4 0.79
5 0.8
6 0.81
7 0.83
8 0.9
9 0.92
10 0.91
11 0.93
12 0.93
13 0.92
14 0.92
15 0.93
16 0.92
17 0.9
18 0.86
19 0.81
20 0.71
21 0.63
22 0.54
23 0.45
24 0.36
25 0.27
26 0.22
27 0.16
28 0.15
29 0.15
30 0.15
31 0.13
32 0.14
33 0.14
34 0.15
35 0.15
36 0.17
37 0.15
38 0.17
39 0.19
40 0.2
41 0.24
42 0.23
43 0.25
44 0.25
45 0.27
46 0.27
47 0.25
48 0.25
49 0.21
50 0.2
51 0.17
52 0.16
53 0.12
54 0.08
55 0.09
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.07
65 0.05
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.03
93 0.03
94 0.06
95 0.08
96 0.08
97 0.1
98 0.12
99 0.13
100 0.15
101 0.2
102 0.19
103 0.2
104 0.21
105 0.19
106 0.17
107 0.17
108 0.17
109 0.12
110 0.15
111 0.13
112 0.14
113 0.18
114 0.27
115 0.34
116 0.37
117 0.44
118 0.49
119 0.59
120 0.58
121 0.6
122 0.6
123 0.59
124 0.56
125 0.5
126 0.42
127 0.34
128 0.33
129 0.27
130 0.18
131 0.12
132 0.11
133 0.1
134 0.1
135 0.08
136 0.08
137 0.08
138 0.09
139 0.09
140 0.08
141 0.08
142 0.09
143 0.09
144 0.1
145 0.11
146 0.1
147 0.12
148 0.21
149 0.26
150 0.26
151 0.27
152 0.27
153 0.28
154 0.3
155 0.28
156 0.19
157 0.15
158 0.16
159 0.18
160 0.21
161 0.21
162 0.22
163 0.22
164 0.21
165 0.2
166 0.2
167 0.21
168 0.2
169 0.22
170 0.27
171 0.28
172 0.27
173 0.27
174 0.25
175 0.22
176 0.21
177 0.17