Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0WZS1

Protein Details
Accession A0A4T0WZS1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-117MEQPIPQREQPQRPRKFNNNNNNGGYRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037447  Rps10  
IPR005326  S10_plectin_N  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Pfam View protein in Pfam  
PF03501  S10_plectin  
Amino Acid Sequences MIIPKADRKNIFMALFKDGVLVAKKDYEIQHDALNVKNLYVIKAMQSLTSKGFVKTQFSWQYYYYTLTDEGLEFLREFLGVPEGIVPATLMEQPIPQREQPQRPRKFNNNNNNGGYRKRDRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.31
4 0.26
5 0.2
6 0.2
7 0.18
8 0.16
9 0.12
10 0.13
11 0.14
12 0.17
13 0.18
14 0.21
15 0.22
16 0.23
17 0.23
18 0.24
19 0.25
20 0.23
21 0.27
22 0.21
23 0.17
24 0.19
25 0.17
26 0.16
27 0.16
28 0.14
29 0.1
30 0.13
31 0.14
32 0.13
33 0.14
34 0.14
35 0.14
36 0.17
37 0.17
38 0.15
39 0.19
40 0.18
41 0.21
42 0.21
43 0.27
44 0.3
45 0.31
46 0.32
47 0.29
48 0.3
49 0.27
50 0.28
51 0.2
52 0.15
53 0.14
54 0.12
55 0.12
56 0.1
57 0.1
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.04
75 0.05
76 0.06
77 0.05
78 0.06
79 0.08
80 0.1
81 0.15
82 0.18
83 0.18
84 0.26
85 0.34
86 0.44
87 0.53
88 0.62
89 0.68
90 0.74
91 0.82
92 0.85
93 0.88
94 0.88
95 0.88
96 0.87
97 0.85
98 0.8
99 0.77
100 0.7
101 0.64
102 0.62