Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X5T3

Protein Details
Accession A0A4T0X5T3   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
104-129QVITNRSRNFRNNRNKIFRDKKEPKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences KPVEDNLPKWDTFEISCRLSGFCIQTRKVASNIGTNFPDHSSFEPLLDIIGLFLDSPGQVDIVELIKAIHVKVRQRCKLKPMSKVFTFTDESSTDMPKEEIKVQVITNRSRNFRNNRNKIFRDKKEPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.26
4 0.25
5 0.24
6 0.23
7 0.25
8 0.24
9 0.26
10 0.3
11 0.3
12 0.34
13 0.37
14 0.37
15 0.35
16 0.34
17 0.3
18 0.32
19 0.33
20 0.32
21 0.3
22 0.28
23 0.27
24 0.25
25 0.24
26 0.18
27 0.18
28 0.18
29 0.18
30 0.17
31 0.16
32 0.14
33 0.13
34 0.11
35 0.09
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.07
57 0.1
58 0.16
59 0.23
60 0.33
61 0.4
62 0.46
63 0.49
64 0.54
65 0.62
66 0.62
67 0.65
68 0.64
69 0.65
70 0.61
71 0.62
72 0.55
73 0.49
74 0.46
75 0.37
76 0.31
77 0.24
78 0.25
79 0.22
80 0.22
81 0.18
82 0.15
83 0.16
84 0.14
85 0.16
86 0.16
87 0.18
88 0.19
89 0.21
90 0.21
91 0.25
92 0.28
93 0.32
94 0.37
95 0.4
96 0.42
97 0.46
98 0.54
99 0.59
100 0.65
101 0.7
102 0.73
103 0.78
104 0.84
105 0.84
106 0.86
107 0.87
108 0.86
109 0.86