Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0WVB5

Protein Details
Accession A0A4T0WVB5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
169-192LDTPSKVRRLRKAMDKHVKYRPIHBasic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR018465  Scm3/HJURP  
Gene Ontology GO:0005634  C:nucleus  
GO:0042393  F:histone binding  
GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF10384  Scm3  
Amino Acid Sequences MDTLEILQRRDDALKRVRSAWQDIIKRYSSVKMQDEGDIVDLQTGEIVNDNGHLRSLTEKADSIWAHEKNQTKKNQTKTISSSKKLPNNINISKPIEIIELDKQPSITNSKHLTRSKVAGDDNLILQYRSKHNQTNNKTTFLPRSGILQNNNSNLSNDPMNLLKSLPSLDTPSKVRRLRKAMDKHVKYRPIHSLILRTSRNTASSILKSKSGSNKSKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.48
4 0.52
5 0.51
6 0.54
7 0.55
8 0.55
9 0.53
10 0.55
11 0.57
12 0.53
13 0.5
14 0.45
15 0.41
16 0.37
17 0.38
18 0.37
19 0.35
20 0.35
21 0.35
22 0.34
23 0.3
24 0.27
25 0.2
26 0.15
27 0.13
28 0.11
29 0.09
30 0.08
31 0.07
32 0.05
33 0.06
34 0.06
35 0.05
36 0.08
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.11
43 0.13
44 0.12
45 0.13
46 0.13
47 0.13
48 0.19
49 0.19
50 0.2
51 0.26
52 0.26
53 0.27
54 0.32
55 0.38
56 0.39
57 0.47
58 0.51
59 0.52
60 0.58
61 0.64
62 0.68
63 0.64
64 0.63
65 0.62
66 0.65
67 0.64
68 0.59
69 0.59
70 0.57
71 0.6
72 0.59
73 0.57
74 0.53
75 0.55
76 0.56
77 0.51
78 0.48
79 0.45
80 0.4
81 0.36
82 0.28
83 0.2
84 0.17
85 0.15
86 0.14
87 0.14
88 0.14
89 0.14
90 0.14
91 0.13
92 0.14
93 0.16
94 0.13
95 0.16
96 0.19
97 0.22
98 0.3
99 0.32
100 0.35
101 0.33
102 0.35
103 0.32
104 0.32
105 0.29
106 0.22
107 0.22
108 0.19
109 0.17
110 0.15
111 0.14
112 0.1
113 0.1
114 0.12
115 0.15
116 0.18
117 0.21
118 0.25
119 0.32
120 0.42
121 0.49
122 0.57
123 0.56
124 0.55
125 0.53
126 0.51
127 0.48
128 0.4
129 0.35
130 0.24
131 0.26
132 0.27
133 0.3
134 0.31
135 0.32
136 0.34
137 0.35
138 0.37
139 0.32
140 0.29
141 0.25
142 0.24
143 0.19
144 0.15
145 0.14
146 0.13
147 0.14
148 0.13
149 0.12
150 0.11
151 0.1
152 0.11
153 0.11
154 0.11
155 0.15
156 0.16
157 0.2
158 0.24
159 0.29
160 0.37
161 0.43
162 0.48
163 0.53
164 0.59
165 0.63
166 0.69
167 0.73
168 0.75
169 0.8
170 0.8
171 0.79
172 0.8
173 0.81
174 0.73
175 0.69
176 0.67
177 0.61
178 0.59
179 0.54
180 0.53
181 0.5
182 0.57
183 0.53
184 0.46
185 0.45
186 0.43
187 0.41
188 0.35
189 0.33
190 0.31
191 0.35
192 0.4
193 0.38
194 0.4
195 0.39
196 0.44
197 0.51
198 0.54
199 0.55