Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X3G3

Protein Details
Accession A0A4T0X3G3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AQRVTFRRRNPYNTKSNQIKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTFRRRNPYNTKSNQIKVVKTPGGRLVAQHIKKKASRPKCGDCGIALAGVATLRPRAYANISKTQKSVSRAYGGSRCANCVKERVVRAFLIEEQKVVKKVLKEAAAKEAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.78
4 0.74
5 0.74
6 0.69
7 0.63
8 0.57
9 0.58
10 0.54
11 0.47
12 0.46
13 0.41
14 0.4
15 0.37
16 0.32
17 0.32
18 0.36
19 0.4
20 0.43
21 0.42
22 0.43
23 0.46
24 0.54
25 0.56
26 0.57
27 0.61
28 0.63
29 0.67
30 0.68
31 0.68
32 0.6
33 0.5
34 0.43
35 0.34
36 0.25
37 0.17
38 0.11
39 0.08
40 0.06
41 0.06
42 0.03
43 0.04
44 0.03
45 0.04
46 0.05
47 0.06
48 0.11
49 0.17
50 0.21
51 0.3
52 0.33
53 0.34
54 0.34
55 0.36
56 0.35
57 0.34
58 0.33
59 0.26
60 0.28
61 0.28
62 0.31
63 0.32
64 0.32
65 0.34
66 0.3
67 0.31
68 0.3
69 0.32
70 0.29
71 0.29
72 0.3
73 0.31
74 0.35
75 0.36
76 0.36
77 0.34
78 0.34
79 0.33
80 0.32
81 0.32
82 0.28
83 0.24
84 0.24
85 0.28
86 0.28
87 0.27
88 0.27
89 0.23
90 0.29
91 0.35
92 0.39
93 0.4
94 0.41
95 0.49