Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4T0X373

Protein Details
Accession A0A4T0X373    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKSSAKAPKKIKQRLDTQFTCHydrophilic
NLS Segment(s)
PositionSequence
3-15KRKSSAKAPKKIK
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSAKAPKKIKQRLDTQFTCLFCNHEKSINCTIDKKANIGTLNCKICGQSFQTSINSLSEPIDIYSNWIDACEAVAEEESKNSKEDFGEVGSDFEDDKKIGNGSQISKVEEDSEDEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.82
4 0.81
5 0.81
6 0.75
7 0.7
8 0.66
9 0.58
10 0.52
11 0.42
12 0.36
13 0.3
14 0.33
15 0.29
16 0.3
17 0.3
18 0.34
19 0.42
20 0.43
21 0.41
22 0.38
23 0.39
24 0.39
25 0.39
26 0.34
27 0.28
28 0.28
29 0.28
30 0.27
31 0.29
32 0.29
33 0.3
34 0.29
35 0.27
36 0.23
37 0.21
38 0.22
39 0.21
40 0.17
41 0.17
42 0.19
43 0.2
44 0.21
45 0.21
46 0.19
47 0.15
48 0.12
49 0.11
50 0.09
51 0.08
52 0.07
53 0.07
54 0.06
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.06
62 0.07
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.06
69 0.08
70 0.09
71 0.1
72 0.11
73 0.11
74 0.12
75 0.11
76 0.13
77 0.13
78 0.12
79 0.14
80 0.13
81 0.13
82 0.12
83 0.13
84 0.11
85 0.1
86 0.11
87 0.08
88 0.09
89 0.1
90 0.11
91 0.12
92 0.16
93 0.2
94 0.22
95 0.3
96 0.31
97 0.32
98 0.32
99 0.32
100 0.29
101 0.25