Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DC31

Protein Details
Accession A5DC31    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
108-134KEPAEPVKSKSRQRAKKRKTTLSTMLAHydrophilic
NLS Segment(s)
PositionSequence
114-126VKSKSRQRAKKRK
Subcellular Location(s) mito 15.5, cyto_mito 9.833, nucl 8.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG pgu:PGUG_00836  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MSGNQTVSTSALHFLNLSHATASSPLNRRYTYLFSNHVADHEIVLPNEFESQRFCLKCGLKYIPGVNVKIRVDYKRKDGVSANKLVYTCSGCNSRHRFDLEVPTKVTKEPAEPVKSKSRQRAKKRKTTLSTMLAQKKSETNKPSLDLMKFMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.16
3 0.16
4 0.16
5 0.14
6 0.14
7 0.14
8 0.16
9 0.18
10 0.19
11 0.25
12 0.28
13 0.33
14 0.33
15 0.34
16 0.37
17 0.4
18 0.37
19 0.35
20 0.35
21 0.32
22 0.35
23 0.33
24 0.29
25 0.26
26 0.22
27 0.18
28 0.16
29 0.15
30 0.12
31 0.13
32 0.12
33 0.1
34 0.13
35 0.12
36 0.1
37 0.11
38 0.14
39 0.2
40 0.2
41 0.2
42 0.24
43 0.27
44 0.28
45 0.32
46 0.32
47 0.29
48 0.31
49 0.31
50 0.31
51 0.32
52 0.31
53 0.26
54 0.28
55 0.25
56 0.26
57 0.27
58 0.25
59 0.28
60 0.29
61 0.34
62 0.36
63 0.36
64 0.35
65 0.37
66 0.41
67 0.4
68 0.42
69 0.37
70 0.32
71 0.32
72 0.29
73 0.26
74 0.21
75 0.16
76 0.14
77 0.18
78 0.17
79 0.26
80 0.32
81 0.33
82 0.34
83 0.36
84 0.35
85 0.34
86 0.43
87 0.4
88 0.37
89 0.37
90 0.35
91 0.34
92 0.32
93 0.31
94 0.22
95 0.2
96 0.22
97 0.28
98 0.32
99 0.34
100 0.39
101 0.46
102 0.53
103 0.57
104 0.61
105 0.64
106 0.68
107 0.77
108 0.84
109 0.84
110 0.87
111 0.9
112 0.91
113 0.87
114 0.85
115 0.82
116 0.77
117 0.74
118 0.73
119 0.72
120 0.64
121 0.58
122 0.52
123 0.5
124 0.5
125 0.51
126 0.47
127 0.45
128 0.46
129 0.49
130 0.53
131 0.52
132 0.47