Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X033

Protein Details
Accession A0A4T0X033   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
3-26HTPIIKMPKKRSANGRNKNGRGHVHydrophilic
92-113VRVRSREDRKIRTPPVRQRFNQHydrophilic
NLS Segment(s)
PositionSequence
10-24PKKRSANGRNKNGRG
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MYHTPIIKMPKKRSANGRNKNGRGHVKPVRCVNCSRCVPKDKAIKRMTVRNMVESAAVRDISEASVYDEYPIPKMYNKIHYCVSCAIHSRVVRVRSREDRKIRTPPVRQRFNQGAKRVSPADAAKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.81
4 0.84
5 0.84
6 0.83
7 0.82
8 0.8
9 0.78
10 0.71
11 0.7
12 0.68
13 0.64
14 0.65
15 0.68
16 0.65
17 0.58
18 0.6
19 0.56
20 0.56
21 0.57
22 0.56
23 0.53
24 0.54
25 0.55
26 0.57
27 0.63
28 0.58
29 0.61
30 0.59
31 0.59
32 0.57
33 0.61
34 0.58
35 0.57
36 0.52
37 0.45
38 0.42
39 0.35
40 0.32
41 0.24
42 0.21
43 0.13
44 0.12
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.05
51 0.06
52 0.06
53 0.07
54 0.07
55 0.09
56 0.09
57 0.1
58 0.1
59 0.09
60 0.1
61 0.14
62 0.17
63 0.25
64 0.26
65 0.28
66 0.32
67 0.32
68 0.33
69 0.33
70 0.32
71 0.25
72 0.27
73 0.26
74 0.28
75 0.28
76 0.29
77 0.31
78 0.35
79 0.37
80 0.38
81 0.44
82 0.48
83 0.56
84 0.62
85 0.66
86 0.68
87 0.71
88 0.77
89 0.78
90 0.78
91 0.8
92 0.81
93 0.82
94 0.83
95 0.77
96 0.76
97 0.77
98 0.78
99 0.76
100 0.72
101 0.69
102 0.61
103 0.66
104 0.59
105 0.5
106 0.46
107 0.44