Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X4T9

Protein Details
Accession A0A4T0X4T9   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-115SLQKSKYRNNFSKKKVHRKEKKLYSIYCKLKHydrophilic
NLS Segment(s)
PositionSequence
96-106SKKKVHRKEKK
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, pero 3
Family & Domain DBs
Amino Acid Sequences MVFYIGESTLETLPGTLTPPSAIYSPPPKLTDSCIQNSCTSTPLNFGKKWDKIERNVPLFNKQLTLKLEALAEKKWKKVTFDVDSLQKSKYRNNFSKKKVHRKEKKLYSIYCKLKSGEYKLINTIIAKTFHVTKRVNEGDLID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.08
4 0.08
5 0.09
6 0.1
7 0.11
8 0.11
9 0.12
10 0.15
11 0.22
12 0.26
13 0.29
14 0.3
15 0.3
16 0.31
17 0.36
18 0.38
19 0.37
20 0.39
21 0.38
22 0.38
23 0.38
24 0.39
25 0.34
26 0.28
27 0.23
28 0.17
29 0.19
30 0.24
31 0.27
32 0.26
33 0.3
34 0.36
35 0.39
36 0.45
37 0.49
38 0.48
39 0.48
40 0.56
41 0.59
42 0.56
43 0.56
44 0.51
45 0.47
46 0.44
47 0.4
48 0.34
49 0.27
50 0.26
51 0.23
52 0.25
53 0.21
54 0.19
55 0.19
56 0.19
57 0.19
58 0.17
59 0.22
60 0.2
61 0.22
62 0.27
63 0.27
64 0.28
65 0.32
66 0.37
67 0.35
68 0.37
69 0.38
70 0.38
71 0.39
72 0.37
73 0.34
74 0.29
75 0.26
76 0.28
77 0.34
78 0.38
79 0.44
80 0.53
81 0.61
82 0.65
83 0.74
84 0.78
85 0.81
86 0.83
87 0.85
88 0.86
89 0.87
90 0.91
91 0.91
92 0.91
93 0.88
94 0.83
95 0.81
96 0.81
97 0.79
98 0.72
99 0.65
100 0.56
101 0.54
102 0.53
103 0.51
104 0.51
105 0.47
106 0.45
107 0.45
108 0.45
109 0.4
110 0.35
111 0.31
112 0.26
113 0.23
114 0.21
115 0.21
116 0.27
117 0.29
118 0.36
119 0.35
120 0.35
121 0.44
122 0.47
123 0.46