Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0WZ22

Protein Details
Accession A0A4T0WZ22   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAPQLKAKIVKKHTKKFKRHHHDRYHRVGESBasic
NLS Segment(s)
PositionSequence
7-22AKIVKKHTKKFKRHHH
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAPQLKAKIVKKHTKKFKRHHHDRYHRVGESWRLQKGIDSCVRRRFRGTISAPKIGYGSNKKTKFLRPDGKKAFVVSNLKDLEVLLLHTETYAAEIAHNVSAKNRVEILSKAKAIGVKVTNPKGRVTLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.9
4 0.92
5 0.92
6 0.93
7 0.94
8 0.94
9 0.94
10 0.93
11 0.93
12 0.89
13 0.79
14 0.7
15 0.63
16 0.6
17 0.57
18 0.54
19 0.45
20 0.38
21 0.36
22 0.38
23 0.35
24 0.35
25 0.33
26 0.33
27 0.36
28 0.46
29 0.49
30 0.47
31 0.49
32 0.45
33 0.41
34 0.45
35 0.46
36 0.46
37 0.48
38 0.51
39 0.47
40 0.44
41 0.41
42 0.32
43 0.32
44 0.27
45 0.3
46 0.34
47 0.35
48 0.37
49 0.4
50 0.45
51 0.47
52 0.5
53 0.53
54 0.5
55 0.59
56 0.62
57 0.63
58 0.58
59 0.52
60 0.44
61 0.4
62 0.38
63 0.29
64 0.29
65 0.26
66 0.25
67 0.23
68 0.22
69 0.16
70 0.12
71 0.11
72 0.06
73 0.06
74 0.05
75 0.05
76 0.06
77 0.05
78 0.06
79 0.06
80 0.05
81 0.05
82 0.06
83 0.07
84 0.09
85 0.1
86 0.09
87 0.1
88 0.16
89 0.17
90 0.18
91 0.19
92 0.18
93 0.2
94 0.24
95 0.29
96 0.29
97 0.29
98 0.28
99 0.28
100 0.29
101 0.27
102 0.3
103 0.27
104 0.28
105 0.36
106 0.44
107 0.48
108 0.48
109 0.49
110 0.46