Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0WY99

Protein Details
Accession A0A4T0WY99   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
206-229KGSVNNSDNKKDKKKSFFSRILKKHydrophilic
NLS Segment(s)
PositionSequence
175-181PREKERK
217-221DKKKS
Subcellular Location(s) cyto 13.5, cyto_nucl 12.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MSIVFRWPSGPKEVIVTGTFDDWSKQFALIKQNDGNFELEVPLPNTEDKIEFKFIVDGEWTISEDYWTVVDESGNVNNYVEVNGGTVKSKDIDHRGIVGKTIIPESGLSIRGEDKVEDKVEDKDAKVPLAGVEPASAEEKVANSAAEKEETAKEEEEKRGAVGNVGAKDKDAPAPREKERKYVKRVVKSSSSGDGKTDGDNTQTNKGSVNNSDNKKDKKKSFFSRILKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.26
4 0.2
5 0.2
6 0.2
7 0.15
8 0.16
9 0.13
10 0.15
11 0.14
12 0.14
13 0.16
14 0.2
15 0.29
16 0.3
17 0.36
18 0.38
19 0.4
20 0.41
21 0.39
22 0.37
23 0.27
24 0.24
25 0.2
26 0.16
27 0.15
28 0.14
29 0.13
30 0.12
31 0.12
32 0.13
33 0.13
34 0.14
35 0.15
36 0.18
37 0.2
38 0.19
39 0.2
40 0.21
41 0.2
42 0.18
43 0.17
44 0.13
45 0.11
46 0.11
47 0.11
48 0.1
49 0.1
50 0.08
51 0.08
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.08
60 0.1
61 0.11
62 0.1
63 0.1
64 0.1
65 0.1
66 0.09
67 0.08
68 0.06
69 0.06
70 0.06
71 0.06
72 0.07
73 0.07
74 0.07
75 0.08
76 0.09
77 0.12
78 0.17
79 0.19
80 0.19
81 0.22
82 0.25
83 0.23
84 0.23
85 0.2
86 0.16
87 0.14
88 0.14
89 0.1
90 0.07
91 0.07
92 0.08
93 0.09
94 0.1
95 0.09
96 0.09
97 0.1
98 0.1
99 0.11
100 0.1
101 0.09
102 0.1
103 0.11
104 0.11
105 0.12
106 0.12
107 0.15
108 0.16
109 0.16
110 0.18
111 0.18
112 0.17
113 0.16
114 0.15
115 0.11
116 0.11
117 0.11
118 0.07
119 0.06
120 0.06
121 0.07
122 0.08
123 0.08
124 0.06
125 0.06
126 0.06
127 0.07
128 0.08
129 0.07
130 0.06
131 0.08
132 0.09
133 0.09
134 0.09
135 0.1
136 0.12
137 0.13
138 0.15
139 0.14
140 0.16
141 0.2
142 0.22
143 0.21
144 0.2
145 0.18
146 0.19
147 0.18
148 0.16
149 0.15
150 0.16
151 0.18
152 0.19
153 0.19
154 0.16
155 0.17
156 0.18
157 0.21
158 0.23
159 0.24
160 0.3
161 0.36
162 0.43
163 0.53
164 0.53
165 0.57
166 0.62
167 0.67
168 0.69
169 0.72
170 0.74
171 0.74
172 0.77
173 0.74
174 0.71
175 0.65
176 0.61
177 0.6
178 0.54
179 0.45
180 0.41
181 0.38
182 0.31
183 0.29
184 0.27
185 0.2
186 0.19
187 0.23
188 0.25
189 0.29
190 0.3
191 0.29
192 0.28
193 0.3
194 0.31
195 0.32
196 0.38
197 0.4
198 0.43
199 0.51
200 0.58
201 0.65
202 0.71
203 0.75
204 0.76
205 0.77
206 0.82
207 0.84
208 0.86
209 0.87