Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0WVF6

Protein Details
Accession A0A4T0WVF6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
305-328DSSTTKLTPAKKRKVEEPKPINEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014840  HRD  
Pfam View protein in Pfam  
PF08729  HUN  
Amino Acid Sequences MTENRSNRNIPISSLVTNGDTSDNQIDTIKAPQLSNSPHLSTILNPASELTPKAKVMTLSELMNEEEEVSMGNEDASEEDQDELAKEVPKEPIPAIINIEVPLSTHNDIHSEFIFSRLVEEKYGTDTQPTTINKSLWNYDADEDEDEEDGDDDAILEPETNDQQTVYDDEDEIVKSLKIKFAPGLSDIEKEKIVLNEIHKRKMENNKRIGKYDVYDPFIDDEELVYEEDFNANADGWYVWYGELEINNKRAKNPEMVESTKQQKQIRQGRTSNNSTNSNLAQSRAKPLIPPSPQGLSNGAKRGEDSSTTKLTPAKKRKVEEPKPINEDNDGKDKDKDNSSSSTEKHPALIIGSFGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.26
4 0.25
5 0.23
6 0.19
7 0.16
8 0.18
9 0.2
10 0.18
11 0.17
12 0.18
13 0.18
14 0.16
15 0.2
16 0.21
17 0.2
18 0.2
19 0.21
20 0.27
21 0.3
22 0.34
23 0.35
24 0.32
25 0.31
26 0.32
27 0.31
28 0.26
29 0.3
30 0.28
31 0.24
32 0.22
33 0.22
34 0.22
35 0.23
36 0.24
37 0.18
38 0.19
39 0.19
40 0.21
41 0.22
42 0.21
43 0.22
44 0.26
45 0.25
46 0.22
47 0.23
48 0.22
49 0.21
50 0.2
51 0.17
52 0.11
53 0.09
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.09
71 0.1
72 0.12
73 0.12
74 0.14
75 0.17
76 0.18
77 0.2
78 0.19
79 0.24
80 0.23
81 0.23
82 0.24
83 0.22
84 0.21
85 0.19
86 0.19
87 0.12
88 0.11
89 0.11
90 0.12
91 0.11
92 0.11
93 0.11
94 0.13
95 0.14
96 0.16
97 0.15
98 0.14
99 0.13
100 0.14
101 0.15
102 0.12
103 0.14
104 0.15
105 0.16
106 0.14
107 0.15
108 0.13
109 0.17
110 0.19
111 0.17
112 0.16
113 0.15
114 0.16
115 0.21
116 0.22
117 0.22
118 0.23
119 0.24
120 0.25
121 0.26
122 0.27
123 0.23
124 0.23
125 0.19
126 0.17
127 0.17
128 0.16
129 0.14
130 0.13
131 0.12
132 0.1
133 0.09
134 0.08
135 0.07
136 0.06
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.06
147 0.06
148 0.05
149 0.05
150 0.06
151 0.06
152 0.08
153 0.08
154 0.07
155 0.07
156 0.08
157 0.08
158 0.08
159 0.08
160 0.07
161 0.06
162 0.07
163 0.08
164 0.1
165 0.1
166 0.1
167 0.11
168 0.12
169 0.13
170 0.13
171 0.16
172 0.14
173 0.16
174 0.16
175 0.16
176 0.15
177 0.14
178 0.14
179 0.11
180 0.12
181 0.12
182 0.16
183 0.24
184 0.27
185 0.31
186 0.31
187 0.32
188 0.37
189 0.45
190 0.52
191 0.52
192 0.59
193 0.63
194 0.65
195 0.66
196 0.62
197 0.53
198 0.45
199 0.43
200 0.38
201 0.31
202 0.29
203 0.27
204 0.25
205 0.24
206 0.22
207 0.14
208 0.09
209 0.07
210 0.08
211 0.07
212 0.06
213 0.05
214 0.06
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.06
225 0.06
226 0.06
227 0.05
228 0.06
229 0.07
230 0.09
231 0.12
232 0.14
233 0.18
234 0.22
235 0.23
236 0.24
237 0.28
238 0.29
239 0.33
240 0.32
241 0.35
242 0.38
243 0.41
244 0.43
245 0.43
246 0.47
247 0.44
248 0.48
249 0.45
250 0.43
251 0.49
252 0.56
253 0.59
254 0.62
255 0.64
256 0.67
257 0.72
258 0.75
259 0.71
260 0.67
261 0.62
262 0.55
263 0.52
264 0.43
265 0.41
266 0.34
267 0.3
268 0.29
269 0.26
270 0.31
271 0.3
272 0.3
273 0.27
274 0.31
275 0.38
276 0.36
277 0.38
278 0.36
279 0.36
280 0.37
281 0.36
282 0.37
283 0.32
284 0.33
285 0.36
286 0.33
287 0.3
288 0.3
289 0.3
290 0.28
291 0.28
292 0.28
293 0.28
294 0.31
295 0.31
296 0.33
297 0.35
298 0.41
299 0.47
300 0.53
301 0.58
302 0.61
303 0.66
304 0.74
305 0.8
306 0.82
307 0.82
308 0.82
309 0.8
310 0.8
311 0.78
312 0.7
313 0.64
314 0.6
315 0.53
316 0.53
317 0.47
318 0.42
319 0.44
320 0.46
321 0.46
322 0.48
323 0.47
324 0.42
325 0.44
326 0.47
327 0.48
328 0.46
329 0.49
330 0.48
331 0.44
332 0.42
333 0.38
334 0.33
335 0.29
336 0.28