Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X545

Protein Details
Accession A0A4T0X545   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
294-313DIKPLRLRIKRRIYLQNREGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
IPR019467  Hat1_N  
IPR037113  Hat1_N_sf  
IPR017380  Hist_AcTrfase_B-typ_cat-su  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0004402  F:histone acetyltransferase activity  
GO:0016573  P:histone acetylation  
GO:0031509  P:subtelomeric heterochromatin formation  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PF10394  Hat1_N  
CDD cd04301  NAT_SF  
Amino Acid Sequences MKFTAEPTKALGFKPKFTYPIFGDSEQIFGYKDAQVHLAFDCASMKPLLTWKYGEKLSGDVKDVGKVISKFLPEGDFVYNDEERWLKEIEEENFELPEDKIVKRFNDTCRLYKFNLSKDEIGLKLLKRSQILTLFFIEAGSYIEVEGDDRWEIYVLYEEVDGKNEFIGFTTVYKYWKYMIDGSTDFYRSRISQMLVLPPFQGKGYGRRMYESIVEEWRKDEKCVEITVEDPSEEFDELRDKCDVEKFINDGLYRNSFENEEDISELRKITKLTDRQIRRVIEMVQLWKLNDKEDIKPLRLRIKRRIYLQNREGLEDMETSECRSKLEETYLRVLDGYKELVDGLQIRKRRAVDEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.46
4 0.45
5 0.5
6 0.43
7 0.48
8 0.46
9 0.41
10 0.4
11 0.35
12 0.35
13 0.28
14 0.25
15 0.18
16 0.14
17 0.15
18 0.15
19 0.15
20 0.14
21 0.18
22 0.17
23 0.18
24 0.18
25 0.17
26 0.14
27 0.14
28 0.14
29 0.11
30 0.13
31 0.12
32 0.11
33 0.11
34 0.18
35 0.2
36 0.21
37 0.23
38 0.25
39 0.3
40 0.31
41 0.31
42 0.26
43 0.28
44 0.3
45 0.3
46 0.3
47 0.28
48 0.28
49 0.29
50 0.28
51 0.24
52 0.25
53 0.22
54 0.22
55 0.22
56 0.22
57 0.2
58 0.21
59 0.22
60 0.17
61 0.19
62 0.18
63 0.15
64 0.16
65 0.2
66 0.19
67 0.17
68 0.18
69 0.16
70 0.15
71 0.16
72 0.16
73 0.12
74 0.16
75 0.22
76 0.22
77 0.26
78 0.27
79 0.25
80 0.24
81 0.24
82 0.21
83 0.15
84 0.17
85 0.15
86 0.14
87 0.18
88 0.21
89 0.23
90 0.27
91 0.33
92 0.35
93 0.42
94 0.46
95 0.47
96 0.5
97 0.53
98 0.49
99 0.51
100 0.51
101 0.47
102 0.5
103 0.47
104 0.42
105 0.39
106 0.41
107 0.33
108 0.3
109 0.27
110 0.21
111 0.22
112 0.23
113 0.24
114 0.21
115 0.22
116 0.24
117 0.26
118 0.27
119 0.25
120 0.24
121 0.22
122 0.21
123 0.19
124 0.15
125 0.1
126 0.09
127 0.07
128 0.05
129 0.04
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.07
142 0.06
143 0.06
144 0.06
145 0.07
146 0.07
147 0.09
148 0.09
149 0.07
150 0.07
151 0.07
152 0.06
153 0.06
154 0.07
155 0.05
156 0.06
157 0.08
158 0.09
159 0.1
160 0.11
161 0.11
162 0.11
163 0.13
164 0.14
165 0.15
166 0.15
167 0.18
168 0.18
169 0.19
170 0.19
171 0.19
172 0.17
173 0.14
174 0.14
175 0.11
176 0.13
177 0.14
178 0.13
179 0.15
180 0.17
181 0.22
182 0.21
183 0.22
184 0.2
185 0.18
186 0.17
187 0.14
188 0.15
189 0.1
190 0.16
191 0.23
192 0.27
193 0.27
194 0.28
195 0.29
196 0.28
197 0.3
198 0.26
199 0.21
200 0.23
201 0.23
202 0.22
203 0.23
204 0.28
205 0.25
206 0.24
207 0.23
208 0.2
209 0.21
210 0.22
211 0.22
212 0.16
213 0.16
214 0.18
215 0.17
216 0.13
217 0.11
218 0.11
219 0.1
220 0.1
221 0.09
222 0.07
223 0.13
224 0.13
225 0.15
226 0.15
227 0.14
228 0.15
229 0.2
230 0.21
231 0.18
232 0.2
233 0.2
234 0.22
235 0.25
236 0.24
237 0.21
238 0.22
239 0.23
240 0.22
241 0.21
242 0.2
243 0.17
244 0.17
245 0.18
246 0.15
247 0.13
248 0.13
249 0.12
250 0.13
251 0.13
252 0.13
253 0.12
254 0.14
255 0.13
256 0.16
257 0.24
258 0.29
259 0.37
260 0.46
261 0.51
262 0.56
263 0.63
264 0.61
265 0.55
266 0.51
267 0.45
268 0.4
269 0.39
270 0.35
271 0.31
272 0.31
273 0.29
274 0.31
275 0.29
276 0.25
277 0.28
278 0.28
279 0.28
280 0.36
281 0.41
282 0.4
283 0.44
284 0.49
285 0.52
286 0.56
287 0.6
288 0.61
289 0.66
290 0.69
291 0.72
292 0.78
293 0.77
294 0.81
295 0.8
296 0.77
297 0.67
298 0.63
299 0.56
300 0.46
301 0.38
302 0.27
303 0.23
304 0.18
305 0.17
306 0.17
307 0.21
308 0.2
309 0.19
310 0.21
311 0.22
312 0.22
313 0.32
314 0.34
315 0.35
316 0.42
317 0.42
318 0.4
319 0.38
320 0.35
321 0.28
322 0.25
323 0.22
324 0.15
325 0.14
326 0.14
327 0.13
328 0.15
329 0.17
330 0.21
331 0.25
332 0.3
333 0.32
334 0.38
335 0.4